NBP257950PE
Novus Biologicals™ COQ7 Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP257950PE-Each-of-1 | In Stock | ₹ 31,372.50 |
NBP257950PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 31,372.50
GST (18%): ₹ 5,647.05
Total Price: ₹ 37,019.55
Gene ID (Entrez)
10229
Common Name
COQ7 Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4
Gene Alias
CAT5, CLK1, CLK-1, Coenzyme Q biosynthesis protein 7 homolog, coenzyme Q, 7 (rat, yeast) homolog, coenzyme Q7 homolog, ubiquinone (yeast), COQ7 coenzyme Q, 7 homolog ubiquinone, placental protein KG-20, Timing protein clk-1 homolog, ubiquinone biosynthesi
Label Type
Unlabeled
Quantity
100μL
Source
E.coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
COQ7
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53326. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human COQ7
- Source: E.coli Amino Acid Sequence: TALLGKEGAMACTVAVEESIAHHYNNQIRTLMEEDPEKYEELLQLIKKFR The COQ7 Recombinant Protein Antigen is derived from E
- coli
- The COQ7 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 10229
Common Name: COQ7 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: CAT5, CLK1, CLK-1, Coenzyme Q biosynthesis protein 7 homolog, coenzyme Q, 7 (rat, yeast) homolog, coenzyme Q7 homolog, ubiquinone (yeast), COQ7 coenzyme Q, 7 homolog ubiquinone, placental protein KG-20, Timing protein clk-1 homolog, ubiquinone biosynthesi
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: COQ7
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53326. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
10229
Common Name:
COQ7 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4
Gene Alias:
CAT5, CLK1, CLK-1, Coenzyme Q biosynthesis protein 7 homolog, coenzyme Q, 7 (rat, yeast) homolog, coenzyme Q7 homolog, ubiquinone (yeast), COQ7 coenzyme Q, 7 homolog ubiquinone, placental protein KG-20, Timing protein clk-1 homolog, ubiquinone biosynthesi
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
COQ7
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53326. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 51306
Common Name: FAM13B1 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: C5orf5, chromosome 5 open reading frame 5, DKFZp667F249, FAM13B1, family with sequence similarity 13, member B, family with sequence similarity 13, member B1, FLJ26735, GAP-like protein N61, hypothetical protein LOC51306, KHCHP, MGC57159, N61
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: FAM13B
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53327. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
51306
Common Name:
FAM13B1 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4
Gene Alias:
C5orf5, chromosome 5 open reading frame 5, DKFZp667F249, FAM13B1, family with sequence similarity 13, member B, family with sequence similarity 13, member B1, FLJ26735, GAP-like protein N61, hypothetical protein LOC51306, KHCHP, MGC57159, N61
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
FAM13B
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53327. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 56144
Common Name: Protocadherin alpha 4 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: CNR1, CNRN1, CRNR1, KIAA0345-like 10, MGC138307, MGC142169, ortholog of mouse CNR1, PCDH-alpha-4, PCDH-ALPHA4, protocadherin alpha 4, protocadherin alpha-4
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: PCDHA4
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53420. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
56144
Common Name:
Protocadherin alpha 4 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4
Gene Alias:
CNR1, CNRN1, CRNR1, KIAA0345-like 10, MGC138307, MGC142169, ortholog of mouse CNR1, PCDH-alpha-4, PCDH-ALPHA4, protocadherin alpha 4, protocadherin alpha-4
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
PCDHA4
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53420. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 1238
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: C-C chemokine receptor D6, CCR10CCR9D6CC-chemokine-binding receptor JAB61, chemokine (C-C) receptor 9, chemokine binding protein 2, Chemokine receptor CCR-10, Chemokine receptor CCR-9, chemokine receptor D6, chemokine-binding protein 2, Chemokine-binding protein D6, CMKBR9chemokine (C-C motif) receptor 9, hD6, MGC126678, MGC138250
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
1238
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
C-C chemokine receptor D6, CCR10CCR9D6CC-chemokine-binding receptor JAB61, chemokine (C-C) receptor 9, chemokine binding protein 2, Chemokine receptor CCR-10, Chemokine receptor CCR-9, chemokine receptor D6, chemokine-binding protein 2, Chemokine-binding protein D6, CMKBR9chemokine (C-C motif) receptor 9, hD6, MGC126678, MGC138250
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__