NBP257978PE
Novus Biologicals™ IGFBP-2 Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP257978PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP257978PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
3485
Common Name
IGFBP-2 Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4
Gene Alias
BP2, IBP2, IBP-2, IGF-binding protein 2, IGFBP-2, IGF-BP53, insulin-like growth factor binding protein 2 (36kD), insulin-like growth factor binding protein 2, 36kDa, insulin-like growth factor-binding protein 2
Label Type
Unlabeled
Quantity
100μL
Source
E.coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
IGFBP2
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53621. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human IGFBP-2
- Source: E.coli Amino Acid Sequence: GLRCYPHPGSELPLQALVMGEGTCEKRRDAEYGASPEQVADNGDDHSEGGLVENHVDS The IGFBP-2 Recombinant Protein Antigen is derived from E
- coli
- The IGFBP-2 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 3485
Common Name: IGFBP-2 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: BP2, IBP2, IBP-2, IGF-binding protein 2, IGFBP-2, IGF-BP53, insulin-like growth factor binding protein 2 (36kD), insulin-like growth factor binding protein 2, 36kDa, insulin-like growth factor-binding protein 2
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: IGFBP2
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53621. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
3485
Common Name:
IGFBP-2 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4
Gene Alias:
BP2, IBP2, IBP-2, IGF-binding protein 2, IGFBP-2, IGF-BP53, insulin-like growth factor binding protein 2 (36kD), insulin-like growth factor binding protein 2, 36kDa, insulin-like growth factor-binding protein 2
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
IGFBP2
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53621. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 10699
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: atrial natriuteric peptide-converting enzyme, Corin, corin, serine peptidase, EC 3.4.21, EC 3.4.21.-, heart specific serine proteinase, Heart-specific serine proteinase ATC2, MGC119742, pro-ANP-convertase, Pro-ANP-converting enzyme, PRSC, serine protease, Transmembrane protease serine 10
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
10699
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
atrial natriuteric peptide-converting enzyme, Corin, corin, serine peptidase, EC 3.4.21, EC 3.4.21.-, heart specific serine proteinase, Heart-specific serine proteinase ATC2, MGC119742, pro-ANP-convertase, Pro-ANP-converting enzyme, PRSC, serine protease, Transmembrane protease serine 10
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 10699
Common Name: Corin Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: atrial natriuteric peptide-converting enzyme, Corin, corin, serine peptidase, EC 3.4.21, EC 3.4.21.-, heart specific serine proteinase, Heart-specific serine proteinase ATC2, MGC119742, pro-ANP-convertase, Pro-ANP-converting enzyme, PRSC, serine protease,
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: CORIN
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53250. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
10699
Common Name:
Corin Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4
Gene Alias:
atrial natriuteric peptide-converting enzyme, Corin, corin, serine peptidase, EC 3.4.21, EC 3.4.21.-, heart specific serine proteinase, Heart-specific serine proteinase ATC2, MGC119742, pro-ANP-convertase, Pro-ANP-converting enzyme, PRSC, serine protease,
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
CORIN
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53250. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 66036
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: DKFZp434K171, LIP-STYX, MGC126672, MTMR8C8orf9, myotubularin related protein 8, myotubularin related protein 9, myotubularin-related protein 9
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
66036
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
DKFZp434K171, LIP-STYX, MGC126672, MTMR8C8orf9, myotubularin related protein 8, myotubularin related protein 9, myotubularin-related protein 9
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__