NBP257991PE
Novus Biologicals™ M-Cadherin/Cadherin-15 Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP257991PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP257991PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
1013
Common Name
M-Cadherin/Cadherin-15 Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4
Gene Alias
cadherin 15, M-cadherin (myotubule), cadherin 15, type 1, M-cadherin (myotubule), Cadherin-14, cadherin-3, CDH14cadherin-14, CDH3cadherin-15, CDHM, MCAD, M-cadherin, MRD3, Muscle cadherin, muscle-cadherin
Label Type
Unlabeled
Quantity
100μL
Source
E.coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
CDH15
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53252. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human M-Cadherin/Cadherin-15
- Source: E.coli Amino Acid Sequence: LSIVKALDYESCEHYELKVSVQNEAPLQAAALRAERGQAKVRVHVQDTNEPPVFQENPLRTSLAEGAPPGTLVAT The M-Cadherin/Cadherin-15 Recombinant Protein Antigen is derived from E
- coli
- The M-Cadherin/Cadherin-15 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 1013
Common Name: M-Cadherin/Cadherin-15 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: cadherin 15, M-cadherin (myotubule), cadherin 15, type 1, M-cadherin (myotubule), Cadherin-14, cadherin-3, CDH14cadherin-14, CDH3cadherin-15, CDHM, MCAD, M-cadherin, MRD3, Muscle cadherin, muscle-cadherin
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: CDH15
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53252. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
1013
Common Name:
M-Cadherin/Cadherin-15 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4
Gene Alias:
cadherin 15, M-cadherin (myotubule), cadherin 15, type 1, M-cadherin (myotubule), Cadherin-14, cadherin-3, CDH14cadherin-14, CDH3cadherin-15, CDHM, MCAD, M-cadherin, MRD3, Muscle cadherin, muscle-cadherin
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
CDH15
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53252. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 8793
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: CD264, CD264 antigen, DcR2, DCR2decoy with truncated death domain, Decoy receptor 2, TNF receptor-related receptor for TRAIL, TNF-related apoptosis-inducing ligand receptor 4, TRAIL-R4, TRAILR4TRAIL receptor 4, TRUNDDTRAIL receptor with a truncated death domain, tumor necrosis factor receptor superfamily member 10D, tumor necrosis factor receptor superfamily, member 10d, decoy with truncateddeath domain
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
8793
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
CD264, CD264 antigen, DcR2, DCR2decoy with truncated death domain, Decoy receptor 2, TNF receptor-related receptor for TRAIL, TNF-related apoptosis-inducing ligand receptor 4, TRAIL-R4, TRAILR4TRAIL receptor 4, TRUNDDTRAIL receptor with a truncated death domain, tumor necrosis factor receptor superfamily member 10D, tumor necrosis factor receptor superfamily, member 10d, decoy with truncateddeath domain
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 8793
Common Name: TRAILR4/TNFRSF10D/DcR2
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: CD264, CD264 antigen, DcR2, DCR2decoy with truncated death domain, Decoy receptor 2, TNF receptor-related receptor for TRAIL, TNF-related apoptosis-inducing ligand receptor 4, TRAIL-R4, TRAILR4TRAIL receptor 4, TRUNDDTRAIL receptor with a truncated death
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: TNFRSF10D
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53254. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
8793
Common Name:
TRAILR4/TNFRSF10D/DcR2
Formulation:
PBS and 1M Urea, pH 7.4
Gene Alias:
CD264, CD264 antigen, DcR2, DCR2decoy with truncated death domain, Decoy receptor 2, TNF receptor-related receptor for TRAIL, TNF-related apoptosis-inducing ligand receptor 4, TRAIL-R4, TRAILR4TRAIL receptor 4, TRUNDDTRAIL receptor with a truncated death
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
TNFRSF10D
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53254. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 11113
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: CITK, citron (rho-interacting, serine/threonine kinase 21), Citron Rho-Interacting Kinase, Citron Rho-Interacting Serine/Threonine Kinase, CRIK, KIAA0949, MCPH17, Rho-interacting Serine/Threonine kinase 21, serine/threonine kinase 21, Serine/threonine-protein kinase 21, STK21
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
11113
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
CITK, citron (rho-interacting, serine/threonine kinase 21), Citron Rho-Interacting Kinase, Citron Rho-Interacting Serine/Threonine Kinase, CRIK, KIAA0949, MCPH17, Rho-interacting Serine/Threonine kinase 21, serine/threonine kinase 21, Serine/threonine-protein kinase 21, STK21
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__