NBP258086PE
Novus Biologicals™ YB1 Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP258086PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP258086PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
4904
Common Name
YB1 Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4.
Gene Alias
BP-8, CBF-A, class II, Y box-binding protein I, CSDA2, CSDB, DBPB CCAAT-binding transcription factor I subunit A, EFI-A, Enhancer factor I subunit A, MDR-NF1, MGC104858, MGC110976, MGC117250, NSEP1 Y-box-binding protein 1, nuclease-sensitive element-bindi
Label Type
Unlabeled
Quantity
100μL
Source
E.Coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
YBX1
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52151. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Related Products
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human YB1
- Source: E.coli Amino Acid Sequence: TQGQQPPQRRYRRNFNYRRRRPENPKPQDGKETKAADPPAENSSAPEAEQ The YB1 Recombinant Protein Antigen is derived from E
- coli
- The YB1 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 4904
Common Name: YB1 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: BP-8, CBF-A, class II, Y box-binding protein I, CSDA2, CSDB, DBPB CCAAT-binding transcription factor I subunit A, EFI-A, Enhancer factor I subunit A, MDR-NF1, MGC104858, MGC110976, MGC117250, NSEP1 Y-box-binding protein 1, nuclease-sensitive element-bindi
Label Type: Unlabeled
Quantity: 100μL
Source: E.Coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: YBX1
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52151. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
4904
Common Name:
YB1 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
BP-8, CBF-A, class II, Y box-binding protein I, CSDA2, CSDB, DBPB CCAAT-binding transcription factor I subunit A, EFI-A, Enhancer factor I subunit A, MDR-NF1, MGC104858, MGC110976, MGC117250, NSEP1 Y-box-binding protein 1, nuclease-sensitive element-bindi
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.Coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
YBX1
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52151. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 9693
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: CNrasGEF, KIAA0313, Neural RAP guanine nucleotide exchange protein, nRap GEP, NRAPGEP, PDZ domain containing guanine nucleotide exchange factor (GEF) 1, PDZGEF1, PDZ-GEF1PDZ domain-containing guanine nucleotide exchange factor 1, RA(Ras/Rap1A-associating)-GEF, RA-GEFDKFZP586O1422, Rap guanine nucleotide exchange factor (GEF) 2, rap guanine nucleotide exchange factor 2, Rap-GEP
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
9693
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
CNrasGEF, KIAA0313, Neural RAP guanine nucleotide exchange protein, nRap GEP, NRAPGEP, PDZ domain containing guanine nucleotide exchange factor (GEF) 1, PDZGEF1, PDZ-GEF1PDZ domain-containing guanine nucleotide exchange factor 1, RA(Ras/Rap1A-associating)-GEF, RA-GEFDKFZP586O1422, Rap guanine nucleotide exchange factor (GEF) 2, rap guanine nucleotide exchange factor 2, Rap-GEP
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 9693
Common Name: RAPGEF2 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: CNrasGEF, KIAA0313, Neural RAP guanine nucleotide exchange protein, nRap GEP, NRAPGEP, PDZ domain containing guanine nucleotide exchange factor (GEF) 1, PDZGEF1, PDZ-GEF1PDZ domain-containing guanine nucleotide exchange factor 1, RA(Ras/Rap1A-associating)
Label Type: Unlabeled
Quantity: 100μL
Source: E.Coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: RAPGEF2
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: Human
Gene ID (Entrez):
9693
Common Name:
RAPGEF2 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
CNrasGEF, KIAA0313, Neural RAP guanine nucleotide exchange protein, nRap GEP, NRAPGEP, PDZ domain containing guanine nucleotide exchange factor (GEF) 1, PDZGEF1, PDZ-GEF1PDZ domain-containing guanine nucleotide exchange factor 1, RA(Ras/Rap1A-associating)
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.Coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
RAPGEF2
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
Human
Gene ID (Entrez): 1783
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: cytoplasmic dynein 1 light intermediate chain 2, DNCLI2, Dynein light intermediate chain 2, cytosolic, dynein, cytoplasmic 1, light intermediate chain 2, dynein, cytoplasmic, light intermediate polypeptide 2, LIC2, LIC-2, LIC53/55
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
1783
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
cytoplasmic dynein 1 light intermediate chain 2, DNCLI2, Dynein light intermediate chain 2, cytosolic, dynein, cytoplasmic 1, light intermediate chain 2, dynein, cytoplasmic, light intermediate polypeptide 2, LIC2, LIC-2, LIC53/55
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__