NBP258351PE
Novus Biologicals™ Cathepsin K Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP258351PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP258351PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
1513
Common Name
Cathepsin K Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4.
Gene Alias
cathepsin K, cathepsin K (pycnodysostosis), Cathepsin O, cathepsin O1, Cathepsin O2, Cathepsin X, CTS02, CTSO, CTSO1, CTSO2, EC 3.4.22, EC 3.4.22.38, MGC23107, PKND, PYCD
Label Type
Unlabeled
Quantity
100μL
Source
E.Coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
CTSK
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51669. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Related Products
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Cathepsin K
- Source: E.coli Amino Acid Sequence: LAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASF The Cathepsin K Recombinant Protein Antigen is derived from E
- coli
- The Cathepsin K Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 1513
Common Name: Cathepsin K Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: cathepsin K, cathepsin K (pycnodysostosis), Cathepsin O, cathepsin O1, Cathepsin O2, Cathepsin X, CTS02, CTSO, CTSO1, CTSO2, EC 3.4.22, EC 3.4.22.38, MGC23107, PKND, PYCD
Label Type: Unlabeled
Quantity: 100μL
Source: E.Coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: CTSK
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51669. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
1513
Common Name:
Cathepsin K Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
cathepsin K, cathepsin K (pycnodysostosis), Cathepsin O, cathepsin O1, Cathepsin O2, Cathepsin X, CTS02, CTSO, CTSO1, CTSO2, EC 3.4.22, EC 3.4.22.38, MGC23107, PKND, PYCD
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.Coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
CTSK
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51669. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 5287
Common Name: PI 3-Kinase C2 beta Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: C2-PI3KDKFZp686G16234, EC 2.7.1, EC 2.7.1.154, phosphatidylinositol 3-kinase C2 domain-containing beta polypeptide, phosphatidylinositol-4-phosphate 3-kinase C2 domain-containing subunit beta, Phosphoinositide 3-kinase-C2-beta, phosphoinositide-3-kinase,
Label Type: Unlabeled
Quantity: 100μL
Source: E.Coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: PIK3C2B
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51670. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
5287
Common Name:
PI 3-Kinase C2 beta Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
C2-PI3KDKFZp686G16234, EC 2.7.1, EC 2.7.1.154, phosphatidylinositol 3-kinase C2 domain-containing beta polypeptide, phosphatidylinositol-4-phosphate 3-kinase C2 domain-containing subunit beta, Phosphoinositide 3-kinase-C2-beta, phosphoinositide-3-kinase,
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.Coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
PIK3C2B
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51670. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 79087
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: alpha-1,6-mannosyltransferase), asparagine-linked glycosylation 12 homolog (S. cerevisiae, asparagine-linked glycosylation 12 homolog (yeast, asparagine-linked glycosylation 12, alpha-1,6-mannosyltransferase homolog (S.cerevisiae), Asparagine-linked glycosylation protein 12 homolog, CDG1G, dolichyl-P-Man:Man(7)GlcNAc(2)-PP-dolichyl-alpha-1,6-mannosyltransferase, dolichyl-P-mannose:Man-7-GlcNAc-2-PP-dolichyl-alpha-6-mannosyltransferase, EC 2.4.1.-, ECM39, hALG12, Mannosyltransferase ALG12 homolog, Membrane protein SB87, MGC111358, MGC3136, PP14673
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
79087
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
alpha-1,6-mannosyltransferase), asparagine-linked glycosylation 12 homolog (S. cerevisiae, asparagine-linked glycosylation 12 homolog (yeast, asparagine-linked glycosylation 12, alpha-1,6-mannosyltransferase homolog (S.cerevisiae), Asparagine-linked glycosylation protein 12 homolog, CDG1G, dolichyl-P-Man:Man(7)GlcNAc(2)-PP-dolichyl-alpha-1,6-mannosyltransferase, dolichyl-P-mannose:Man-7-GlcNAc-2-PP-dolichyl-alpha-6-mannosyltransferase, EC 2.4.1.-, ECM39, hALG12, Mannosyltransferase ALG12 homolog, Membrane protein SB87, MGC111358, MGC3136, PP14673
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 79087
Common Name: ALG12 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: alpha-1,6-mannosyltransferase), asparagine-linked glycosylation 12 homolog (S. cerevisiae, asparagine-linked glycosylation 12 homolog (yeast, asparagine-linked glycosylation 12, alpha-1,6-mannosyltransferase homolog (S.cerevisiae), Asparagine-linked glyco
Label Type: Unlabeled
Quantity: 100μL
Source: E.Coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: ALG12
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51037. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
79087
Common Name:
ALG12 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
alpha-1,6-mannosyltransferase), asparagine-linked glycosylation 12 homolog (S. cerevisiae, asparagine-linked glycosylation 12 homolog (yeast, asparagine-linked glycosylation 12, alpha-1,6-mannosyltransferase homolog (S.cerevisiae), Asparagine-linked glyco
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.Coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
ALG12
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51037. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml