NBP258387PE
Novus Biologicals™ RPB9 Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP258387PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP258387PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
5438
Common Name
RPB9 Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4.
Gene Alias
DNA-directed RNA polymerase II 14.5 kDa polypeptide, DNA-directed RNA polymerase II subunit I, DNA-directed RNA polymerase II subunit RPB9, hRPB14.5, polymerase (RNA) II (DNA directed) polypeptide I (14.5kD), polymerase (RNA) II (DNA directed) polypeptide
Label Type
Unlabeled
Regulatory Status
RUO
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
POLR2I
Product Type
Recombinant Protein Antigen
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51272. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Related Products
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RPB9
- Source: E.coli Amino Acid Sequence: DELTQIIADVSQDPTLPRTEDHPCQKCGHKEAVFFQSHSARAEDAMRLYYVCT The RPB9 Recombinant Protein Antigen is derived from E
- coli
- The RPB9 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 5438
Common Name: RPB9 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: DNA-directed RNA polymerase II 14.5 kDa polypeptide, DNA-directed RNA polymerase II subunit I, DNA-directed RNA polymerase II subunit RPB9, hRPB14.5, polymerase (RNA) II (DNA directed) polypeptide I (14.5kD), polymerase (RNA) II (DNA directed) polypeptide
Label Type: Unlabeled
Regulatory Status: RUO
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: POLR2I
Product Type: Recombinant Protein Antigen
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51272. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
5438
Common Name:
RPB9 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
DNA-directed RNA polymerase II 14.5 kDa polypeptide, DNA-directed RNA polymerase II subunit I, DNA-directed RNA polymerase II subunit RPB9, hRPB14.5, polymerase (RNA) II (DNA directed) polypeptide I (14.5kD), polymerase (RNA) II (DNA directed) polypeptide
Label Type:
Unlabeled
Regulatory Status:
RUO
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
POLR2I
Product Type:
Recombinant Protein Antigen
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51272. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 8382
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: Inhibitor of p53-induced apoptosis-beta, IPIA-beta, NDK-H 5, NDP kinase homolog 5, nm23-H5, NM23H5, non-metastatic cells 5, protein expressed in (nucleoside-diphosphate kinase), nucleoside diphosphate kinase homolog 5, radial spoke 23 homolog, RSPH23, Testis-specific nm23 homolog
Label Type: __
Regulatory Status: RUO
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Specific Reactivity: __
Gene ID (Entrez):
8382
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
Inhibitor of p53-induced apoptosis-beta, IPIA-beta, NDK-H 5, NDP kinase homolog 5, nm23-H5, NM23H5, non-metastatic cells 5, protein expressed in (nucleoside-diphosphate kinase), nucleoside diphosphate kinase homolog 5, radial spoke 23 homolog, RSPH23, Testis-specific nm23 homolog
Label Type:
__
Regulatory Status:
RUO
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Specific Reactivity:
__
Gene ID (Entrez): 5977
Common Name: DPF2 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: Apoptosis response zinc finger protein, D4, zinc and double PHD fingers family 2BAF45D, MGC10180, Protein requiem, REQBRG1-associated factor 45D, requiem, apoptosis response zinc finger, ubi-d4, UBID4requiem, apoptosis response zinc finger gene, zinc fing
Label Type: Unlabeled
Regulatory Status: RUO
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: DPF2
Product Type: Recombinant Protein Antigen
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50336. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
5977
Common Name:
DPF2 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
Apoptosis response zinc finger protein, D4, zinc and double PHD fingers family 2BAF45D, MGC10180, Protein requiem, REQBRG1-associated factor 45D, requiem, apoptosis response zinc finger, ubi-d4, UBID4requiem, apoptosis response zinc finger gene, zinc fing
Label Type:
Unlabeled
Regulatory Status:
RUO
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
DPF2
Product Type:
Recombinant Protein Antigen
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50336. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 92259
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: DC47,28S ribosomal protein S36, mitochondrial, MGC22896, mitochondrial ribosomal protein S36, MRP-S36S36mt
Label Type: __
Regulatory Status: RUO
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Specific Reactivity: __
Gene ID (Entrez):
92259
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
DC47,28S ribosomal protein S36, mitochondrial, MGC22896, mitochondrial ribosomal protein S36, MRP-S36S36mt
Label Type:
__
Regulatory Status:
RUO
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Specific Reactivity:
__