Novus Biologicals™ Integrin alpha 4/CD49d Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NP268992PEP-Each-of-1 | In Stock | ₹ 30,159.90 |
NP268992PEP - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
3676
Content And Storage
Store at -20°C. Avoid freeze-thaw cycles.
For Use With (Application)
Antibody Competition
Gene Symbol
ITGA4
Quantity
100 μL
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55056. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purity
>80% by SDS-PAGE and Coomassie blue staining
Formulation
PBS and 1M Urea, pH 7.4.
Gene Alias
269C wild type, CD49 antigen-like family member D, CD49d, CD49d antigen, CD49Dantigen CD49D, alpha-4 subunit of VLA-4 receptor, IA4, integrin alpha 4, integrin alpha-4, integrin alpha-4 subunit, Integrin alpha-IV, integrin, alpha 4 (antigen CD49D, alpha 4 subunit of VLA-4 receptor), MGC90518, very late activation protein 4 receptor, alpha 4 subunit, VLA-4 subunit alpha
Molecular Weight (g/mol)
28 kDa
Source
E. coli
Storage Buffer
PBS and 1M Urea, pH 7.4.
Related Products
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Integrin alpha 4/CD49d Source: E.coli Amino Acid Sequence: RLLYCIKADPHCLNFLCNFGKMESGKEASVHIQLEGRPSILEMDETSALKFEIRATGFPEPNPRVIELNKDENVAHVLLEGLHHQRPKR
Compare Similar Items
Show Difference
Gene ID (Entrez): 3676
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
For Use With (Application): Antibody Competition
Gene Symbol: ITGA4
Quantity: 100 μL
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55056. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purity: >80% by SDS-PAGE and Coomassie blue staining
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: 269C wild type, CD49 antigen-like family member D, CD49d, CD49d antigen, CD49Dantigen CD49D, alpha-4 subunit of VLA-4 receptor, IA4, integrin alpha 4, integrin alpha-4, integrin alpha-4 subunit, Integrin alpha-IV, integrin, alpha 4 (antigen CD49D, alpha 4 subunit of VLA-4 receptor), MGC90518, very late activation protein 4 receptor, alpha 4 subunit, VLA-4 subunit alpha
Molecular Weight (g/mol): 28 kDa
Source: E. coli
Storage Buffer: PBS and 1M Urea, pH 7.4.
Gene ID (Entrez): 23539
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
For Use With (Application): Antibody Competition
Gene Symbol: SLC16A8
Quantity: 100 μL
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55055. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purity: >80% by SDS-PAGE and Coomassie blue staining
Formulation: __
Gene Alias: __
Molecular Weight (g/mol): 23 kDa
Source: E. coli
Storage Buffer: PBS and 1M Urea, pH 7.4.
Gene ID (Entrez): 57513
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
For Use With (Application): Antibody Competition
Gene Symbol: CASKIN2
Quantity: 100 μL
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55036. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purity: >80% by SDS-PAGE and Coomassie blue staining
Formulation: __
Gene Alias: __
Molecular Weight (g/mol): 26 kDa
Source: E. coli
Storage Buffer: PBS and 1M Urea, pH 7.4.