Novus Biologicals™ Bcl-6 Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NP276541PEP-Each-of-1 | In Stock | ₹ 30,159.90 |
NP276541PEP - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
604
Content And Storage
Store at -20°C. Avoid freeze-thaw cycles.
For Use With (Application)
Antibody Competition
Gene Symbol
BCL6
Quantity
100 μL
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55064. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purity
>80% by SDS-PAGE and Coomassie blue staining
Formulation
PBS and 1M Urea, pH 7.4.
Gene Alias
B-cell CLL/lymphoma 6, B-cell lymphoma 6 protein transcript, BCL-5, BCL5B-cell lymphoma 5 protein, BCL-6, BCL6A, cys-his2 zinc finger transcription factor, LAZ3ZBTB27B-cell lymphoma 6 protein, lymphoma-associated zinc finger gene on chromosome 3, Protein LAZ-3, Zinc finger and BTB domain-containing protein 27, Zinc finger protein 51ZNF51, zinc finger transcription factor BCL6S
Molecular Weight (g/mol)
29 kDa
Source
E. coli
Storage Buffer
PBS and 1M Urea, pH 7.4.
Related Products
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Bcl-6 Source: E.coli Amino Acid Sequence: EHVVDTCRKFIKASEAEMVSAIKPPREEFLNSRMLMPQDIMAYRGREVVENNLPLRSAPGCESRAFAPSLYSGLSTPPASYSMYSHLPVSSLLFSDEEFRDVR
Compare Similar Items
Show Difference
Gene ID (Entrez): 604
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
For Use With (Application): Antibody Competition
Gene Symbol: BCL6
Quantity: 100 μL
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55064. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purity: >80% by SDS-PAGE and Coomassie blue staining
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: B-cell CLL/lymphoma 6, B-cell lymphoma 6 protein transcript, BCL-5, BCL5B-cell lymphoma 5 protein, BCL-6, BCL6A, cys-his2 zinc finger transcription factor, LAZ3ZBTB27B-cell lymphoma 6 protein, lymphoma-associated zinc finger gene on chromosome 3, Protein LAZ-3, Zinc finger and BTB domain-containing protein 27, Zinc finger protein 51ZNF51, zinc finger transcription factor BCL6S
Molecular Weight (g/mol): 29 kDa
Source: E. coli
Storage Buffer: PBS and 1M Urea, pH 7.4.
Gene ID (Entrez): 284677
Content And Storage: Store at -20 C. Avoid freeze-thaw cycles.
For Use With (Application): Antibody Competition
Gene Symbol: SNHG28
Quantity: 100 μL
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55019. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purity: >80% by SDS-PAGE and Coomassie blue staining
Formulation: PBS and 1 M Urea, pH 7.4.
Gene Alias: __
Molecular Weight (g/mol): M.W. (theoretical): 25 kDa
Source: E. coli
Storage Buffer: PBS and 1M Urea, pH 7.4.
Gene ID (Entrez): 84250
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
For Use With (Application): Antibody Competition
Gene Symbol: ANKRD32
Quantity: 100 μL
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-54989. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purity: >80% by SDS-PAGE and Coomassie blue staining
Formulation: __
Gene Alias: __
Molecular Weight (g/mol): 27 kDa
Source: E. coli
Storage Buffer: PBS and 1M Urea, pH 7.4.