For use in research applications
Manufacturer: Fischer Scientific
The price for this product is unavailable. Please request a quote
Human, Mouse, Rat, Hamster, Rabbit, Xenopus
Inhibition of Erk activation
ERK1 Inhibitor Peptide Set
ERK1
ERK Inhibitor peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKKGMPKKKPTPIQLN (ERK inhibitor sequence: GMPKKKPTPIQLN). Molecular weight: 3795. Antennapedia Control peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKK. Molecular weight: 2361
Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
3795
Lyophilized