NBP2293235
Novus Biologicals™ NFkB p50 (NLS) Inhibitor Peptide Set
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP2293235-Each-of-1 | In Stock | ₹ 1,06,436.64 |
NBP2293235 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 1,06,436.64
GST (18%): ₹ 19,158.595
Total Price: ₹ 1,25,595.235
Host Species
Human, Mouse, Rat, Bovine, Canine, Chicken, Xenopus
For Use With (Application)
Functional (Inhibition)
Quantity
5 mg
Molecular Weight (g/mol)
3529
Form
Lyophilized
Components
NF-kB p50 (NLS) Inhibitor peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKKVQRKRQKLM (p50 NLS sequence: VQRKRQKLM). Molecular weight: 3529. Antennapedia Control peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKK. Molecular weight: 2361
Content And Storage
Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Product Type
NFkB p105/p50 Inhibitor Peptide Set
Inhibitors
NFkB p105/p50
Related Products
Compare Similar Items
Show Difference
Host Species: Human, Mouse, Rat, Bovine, Canine, Chicken, Xenopus
For Use With (Application): Functional (Inhibition)
Quantity: 5 mg
Molecular Weight (g/mol): 3529
Form: Lyophilized
Components: NF-kB p50 (NLS) Inhibitor peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKKVQRKRQKLM (p50 NLS sequence: VQRKRQKLM). Molecular weight: 3529. Antennapedia Control peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKK. Molecular weight: 2361
Content And Storage: Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Product Type: NFkB p105/p50 Inhibitor Peptide Set
Inhibitors: NFkB p105/p50
Host Species:
Human, Mouse, Rat, Bovine, Canine, Chicken, Xenopus
For Use With (Application):
Functional (Inhibition)
Quantity:
5 mg
Molecular Weight (g/mol):
3529
Form:
Lyophilized
Components:
NF-kB p50 (NLS) Inhibitor peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKKVQRKRQKLM (p50 NLS sequence: VQRKRQKLM). Molecular weight: 3529. Antennapedia Control peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKK. Molecular weight: 2361
Content And Storage:
Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Product Type:
NFkB p105/p50 Inhibitor Peptide Set
Inhibitors:
NFkB p105/p50
Host Species: Human, Mouse, Rat, Bovine, Xenopus, Yeast, Zebrafish
For Use With (Application): Inhibition of MyD88 dependent TLR/IL-1R signaling activitiy by interefering with MyD88 homodimer formation. Inhibitory peptide at 100 uM concentration may be a starting point. However, useful concentration of peptide may vary depending on experimental condition and cell type. Incubate cells for 24 hr with peptides before stimulating with ligands. Use in Functional inhibition reported in multiple pieces of scientific literature Use in In vivo assay reported in scientific literature (PMID 24755282) Use in blocking neutralizing reported in scientific literature (PMID 24886588) Use in In vitro assay reported in scientific literature (PMID 25810567) Use in ELISA reported in scientific literature (PMID 23469306). Use in FLOW cytometry reported in scientific literature (PMID 27870876) . Use in Binding inhibition reported in scientific literature (PMID 28302163). Use in Immunohistochemistry reported in scientific literature (PMID 28282921).
Quantity: 2 mg
Molecular Weight (g/mol): 3100
Form: Lyophilized
Components: 2 x 1mg: MyD88 Homodimerization Inhibitor peptide (lyophilized) DRQIKIWFQNRRMKWKKRDVLPGT (MyD88 homodimerization sequence: RDVLPGT). Molecular weight: 31002 x 1mg: Antennapedia Control peptide (lyophilized) DRQIKIWFQNRRMKWKK. Molecular weight: 23615mg size will contain 5mg of each peptide (MyD88 Homodimerization Inhibitor peptide and Antennapedia Control peptide)
Content And Storage: Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Product Type: MyD88 Inhibitor Peptide Set
Inhibitors: MyD88
Host Species:
Human, Mouse, Rat, Bovine, Xenopus, Yeast, Zebrafish
For Use With (Application):
Inhibition of MyD88 dependent TLR/IL-1R signaling activitiy by interefering with MyD88 homodimer formation. Inhibitory peptide at 100 uM concentration may be a starting point. However, useful concentration of peptide may vary depending on experimental condition and cell type. Incubate cells for 24 hr with peptides before stimulating with ligands. Use in Functional inhibition reported in multiple pieces of scientific literature Use in In vivo assay reported in scientific literature (PMID 24755282) Use in blocking neutralizing reported in scientific literature (PMID 24886588) Use in In vitro assay reported in scientific literature (PMID 25810567) Use in ELISA reported in scientific literature (PMID 23469306). Use in FLOW cytometry reported in scientific literature (PMID 27870876) . Use in Binding inhibition reported in scientific literature (PMID 28302163). Use in Immunohistochemistry reported in scientific literature (PMID 28282921).
Quantity:
2 mg
Molecular Weight (g/mol):
3100
Form:
Lyophilized
Components:
2 x 1mg: MyD88 Homodimerization Inhibitor peptide (lyophilized) DRQIKIWFQNRRMKWKKRDVLPGT (MyD88 homodimerization sequence: RDVLPGT). Molecular weight: 31002 x 1mg: Antennapedia Control peptide (lyophilized) DRQIKIWFQNRRMKWKK. Molecular weight: 23615mg size will contain 5mg of each peptide (MyD88 Homodimerization Inhibitor peptide and Antennapedia Control peptide)
Content And Storage:
Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Product Type:
MyD88 Inhibitor Peptide Set
Inhibitors:
MyD88
Host Species: Human, Mouse, Rat, Xenopus, Zebrafish
For Use With (Application): Blocking/Neutralizing, ELISA, Functional (Inhibition), In vitro assay, In vivo assay
Quantity: 5 mg
Molecular Weight (g/mol): 3100
Form: Lyophilized
Components: 2 x 1mg: MyD88 Homodimerization Inhibitor peptide (lyophilized) DRQIKIWFQNRRMKWKKRDVLPGT (MyD88 homodimerization sequence: RDVLPGT). Molecular weight: 31002 x 1mg: Antennapedia Control peptide (lyophilized) DRQIKIWFQNRRMKWKK. Molecular weight: 23615mg size will contain 5mg of each peptide (MyD88 Homodimerization Inhibitor peptide and Antennapedia Control peptide)
Content And Storage: Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Product Type: MyD88 Inhibitor Peptide Set
Inhibitors: MyD88
Host Species:
Human, Mouse, Rat, Xenopus, Zebrafish
For Use With (Application):
Blocking/Neutralizing, ELISA, Functional (Inhibition), In vitro assay, In vivo assay
Quantity:
5 mg
Molecular Weight (g/mol):
3100
Form:
Lyophilized
Components:
2 x 1mg: MyD88 Homodimerization Inhibitor peptide (lyophilized) DRQIKIWFQNRRMKWKKRDVLPGT (MyD88 homodimerization sequence: RDVLPGT). Molecular weight: 31002 x 1mg: Antennapedia Control peptide (lyophilized) DRQIKIWFQNRRMKWKK. Molecular weight: 23615mg size will contain 5mg of each peptide (MyD88 Homodimerization Inhibitor peptide and Antennapedia Control peptide)
Content And Storage:
Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Product Type:
MyD88 Inhibitor Peptide Set
Inhibitors:
MyD88
Host Species: Human, Mouse
For Use With (Application): Inhibition of TIRAP binding to TLR2 or TLR4
Quantity: 2 mg
Molecular Weight (g/mol): 3701.4
Form: Lyophilized
Components: TIRAP Inhibitor peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKKLQLRDAAPGGAIVS (TIRAP sequence is underlined). Molecular weight: 3701.4. Antennapedia Control peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKK. Molecular weight: 2361.
Content And Storage: Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Product Type: TIRAP (TLR2 and TLR4) Inhibitor Peptide Set
Inhibitors: TLR2, TLR4
Host Species:
Human, Mouse
For Use With (Application):
Inhibition of TIRAP binding to TLR2 or TLR4
Quantity:
2 mg
Molecular Weight (g/mol):
3701.4
Form:
Lyophilized
Components:
TIRAP Inhibitor peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKKLQLRDAAPGGAIVS (TIRAP sequence is underlined). Molecular weight: 3701.4. Antennapedia Control peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKK. Molecular weight: 2361.
Content And Storage:
Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Product Type:
TIRAP (TLR2 and TLR4) Inhibitor Peptide Set
Inhibitors:
TLR2, TLR4