NLRP3/NALP3 Antibody (Nalpy3-b) - BSA Free, Novus Biologicals™
Mouse Monoclonal Antibody has been used in 4 publications
Manufacturer: Fischer Scientific
The price for this product is unavailable. Please request a quote
Antigen
NLRP3/NALP3
Concentration
1.0 mg/mL
Applications
Western Blot, Immunohistochemistry, Immunoprecipitation, Immunohistochemistry (Paraffin), Immunohistochemistry (Frozen)
Conjugate
Unconjugated
Host Species
Mouse
Research Discipline
Alzheimers Research, Apoptosis, Cancer, Cardiovascular Biology, Cytokine Research, Immunology, Inflammation, Neurodegeneration, Signal Transduction
Gene Alias
AII, AII/AVP, Angiotensin/vasopressin receptor AII/AVP-like, AVP, C1orf7, Caterpiller protein 1.1, CLR1.1, Cold autoinflammatory syndrome 1, Cold autoinflammatory syndrome 1 protein, Cryopyrin, Familial cold autoinflammatory syndrome, FCU, Leucine-rich repeat-, and PYD-containing protein 3, Muckle-Wells syndrome, MWS, NACHT, LRR and PYD containing protein 3, NACHT, LRR and PYD domains-containing protein 3, NALP3, NLR family, pyrin domain containing 3, NLRP3, Nucleotide-Binding Oligomerization Domain, Leucine Rich Repeat And Pyrin Domain Containing 3, PYPAF1, PYRIN-containing APAF1-like protein 1
Gene Symbols
NLRP3
Isotype
IgG1
Purification Method
Protein G purified
Test Specificity
Recognizes human NLRP3/NALP3.
Clone
Nalpy3-b
Dilution
Western Blot 1:1000, Immunohistochemistry 1:10-1:500, Immunoprecipitation 1:50, Immunohistochemistry-Paraffin 1:10 - 1:500, Immunohistochemistry-Frozen 1:10-1:500
Classification
Monoclonal
Form
Purified
Regulatory Status
RUO
Target Species
Human
Gene ID (Entrez)
114548
Immunogen
Recombinant human NLRP3/NALP3 Antibody (Nalpy3-b) (NACHT-, LRR- and PYD-containing protein 3) (pyrin domain).
Primary or Secondary
Primary
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Related Products
Description
- NLRP3/NALP3 Monoclonal specifically detects NLRP3/NALP3 in Human samples
- It is validated for Western Blot, Immunohistochemistry, Immunoprecipitation, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen.
Compare Similar Items
Show Difference
Antigen: NLRP3/NALP3
Concentration: 1.0 mg/mL
Applications: Western Blot, Immunohistochemistry, Immunoprecipitation, Immunohistochemistry (Paraffin), Immunohistochemistry (Frozen)
Conjugate: Unconjugated
Host Species: Mouse
Research Discipline: Alzheimers Research, Apoptosis, Cancer, Cardiovascular Biology, Cytokine Research, Immunology, Inflammation, Neurodegeneration, Signal Transduction
Gene Alias: AII, AII/AVP, Angiotensin/vasopressin receptor AII/AVP-like, AVP, C1orf7, Caterpiller protein 1.1, CLR1.1, Cold autoinflammatory syndrome 1, Cold autoinflammatory syndrome 1 protein, Cryopyrin, Familial cold autoinflammatory syndrome, FCU, Leucine-rich repeat-, and PYD-containing protein 3, Muckle-Wells syndrome, MWS, NACHT, LRR and PYD containing protein 3, NACHT, LRR and PYD domains-containing protein 3, NALP3, NLR family, pyrin domain containing 3, NLRP3, Nucleotide-Binding Oligomerization Domain, Leucine Rich Repeat And Pyrin Domain Containing 3, PYPAF1, PYRIN-containing APAF1-like protein 1
Gene Symbols: NLRP3
Isotype: IgG1
Purification Method: Protein G purified
Test Specificity: Recognizes human NLRP3/NALP3.
Clone: Nalpy3-b
Dilution: Western Blot 1:1000, Immunohistochemistry 1:10-1:500, Immunoprecipitation 1:50, Immunohistochemistry-Paraffin 1:10 - 1:500, Immunohistochemistry-Frozen 1:10-1:500
Classification: Monoclonal
Form: Purified
Regulatory Status: RUO
Target Species: Human
Gene ID (Entrez): 114548
Immunogen: Recombinant human NLRP3/NALP3 Antibody (Nalpy3-b) (NACHT-, LRR- and PYD-containing protein 3) (pyrin domain).
Primary or Secondary: Primary
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: BCMA/TNFRSF17
Concentration: 1.0 mg/mL
Applications: Western Blot, Flow Cytometry, ELISA, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Blocking Assay
Conjugate: Unconjugated
Host Species: Rat
Research Discipline: __
Gene Alias: B cell maturation antigen, B-cell maturation protein, BCMAtumor necrosis factor receptor superfamily member 17, BCMB-cell maturation factor, CD269, CD269 antigen, tumor necrosis factor receptor superfamily, member 17
Gene Symbols: TNFRSF17
Isotype: IgG1
Purification Method: Protein G purified
Test Specificity: __
Clone: Vicky-1
Dilution: Western Blot 1:100-1:2000, Flow Cytometry 1:10-1:1000, ELISA 1:100-1:2000, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1:10-1:2000, Blocking/Neutralizing 50-200 molar excess
Classification: Monoclonal
Form: Purified
Regulatory Status: RUO
Target Species: Human
Gene ID (Entrez): 608
Immunogen: Recombinant human BCMA extracellular domain (aa 2-54).
Primary or Secondary: Primary
Content And Storage: Store at -20C. Avoid freeze-thaw cycles.
Antigen: C7orf59
Concentration: __
Applications: Western Blot
Conjugate: Unconjugated
Host Species: Rabbit
Research Discipline: __
Gene Alias: C7orf59, chromosome 7 open reading frame 59, hypothetical protein LOC389541, late endosomal/lysosomal adaptor, MAPK and MTOR activator 4, MGC163425, MGC163431
Gene Symbols: LAMTOR4
Isotype: IgG
Purification Method: __
Test Specificity: __
Clone: __
Dilution: __
Classification: Polyclonal
Form: __
Regulatory Status: RUO
Target Species: __
Gene ID (Entrez): 389541
Immunogen: The immunogen for this antibody is UPF0539 protein C7orf59 N-terminal region. Peptide sequence MTSALTQGLERIPDQLGYLVLSEGAVLASSGDLENDEQAASAISELVSTA.
Primary or Secondary: Primary
Content And Storage: __
