Manufacturer: Novus Biologicals
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NB125091-Each-of-1 | In Stock | ₹ 41,710.50 |
NB125091 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 41,710.50
GST (18%): ₹ 7,507.89
Total Price: ₹ 49,218.39
HLA B
Polyclonal
Western Blot 1.0 ug/ml
ankylosing spondylitis, AS, b'DT, Bw-22, Bw-4, Bw-41, Bw-44, Bw-45, Bw-46, Bw-47, Bw-48, Bw-50, Bw-52, Bw-53, Bw-54, Bw-55, Bw-56, Bw-57, Bw-58, Bw-60, HLA class I histocompatibility antigen, B alpha chain, HLA class I histocompatibility antigen, B-12 alpha chain, HLA class I histocompatibility antigen, B-21 alpha chain, HLA class I histocompatibility antigen, B-5 alpha chain, HLA class I histocompatibility antigen, B-7 alpha chain, HLAB, HLA-B27, HLA-B73, leukocyte antigen class I-B, lymphocyte antigen, major histocompatibility complex, class I, B, MGC111087, MHC class I antigen B*13, MHC class I antigen B*14, MHC class I antigen B*15, MHC class I antigen B*18, MHC class I antigen B*27, MHC class I antigen B*35, MHC class I antigen B*37, MHC class I antigen B*38, MHC class I antigen B*39, MHC class I antigen B*40, MHC class I antigen B*41, MHC class I antigen B*42, MHC class I antigen B*44, MHC class I antigen B*45, MHC class I a
The immunogen is a synthetic peptide directed towards the middle region of human HLA B (XP_011545540.1). Peptide sequence TQRKWEAARVAEQDRAYLEGTCVEWLRRYLENGKDTLERADPPKTHVTHH
100 μg
Adaptive Immunity, Immunology
3106
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Western Blot
Unconjugated
PBS buffer, 2% sucrose
Rabbit
Affinity purified
RUO
Primary
Human
Purified