HLA B Rabbit anti-Human, Polyclonal, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NB125091-Each-of-1 | In Stock | ₹ 41,710.50 |
NB125091 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 41,710.50
GST (18%): ₹ 7,507.89
Total Price: ₹ 49,218.39
Antigen
HLA B
Classification
Polyclonal
Dilution
Western Blot 1.0 ug/ml
Gene Alias
ankylosing spondylitis, AS, b'DT, Bw-22, Bw-4, Bw-41, Bw-44, Bw-45, Bw-46, Bw-47, Bw-48, Bw-50, Bw-52, Bw-53, Bw-54, Bw-55, Bw-56, Bw-57, Bw-58, Bw-60, HLA class I histocompatibility antigen, B alpha chain, HLA class I histocompatibility antigen, B-12 alpha chain, HLA class I histocompatibility antigen, B-21 alpha chain, HLA class I histocompatibility antigen, B-5 alpha chain, HLA class I histocompatibility antigen, B-7 alpha chain, HLAB, HLA-B27, HLA-B73, leukocyte antigen class I-B, lymphocyte antigen, major histocompatibility complex, class I, B, MGC111087, MHC class I antigen B*13, MHC class I antigen B*14, MHC class I antigen B*15, MHC class I antigen B*18, MHC class I antigen B*27, MHC class I antigen B*35, MHC class I antigen B*37, MHC class I antigen B*38, MHC class I antigen B*39, MHC class I antigen B*40, MHC class I antigen B*41, MHC class I antigen B*42, MHC class I antigen B*44, MHC class I antigen B*45, MHC class I a
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human HLA B (XP_011545540.1). Peptide sequence TQRKWEAARVAEQDRAYLEGTCVEWLRRYLENGKDTLERADPPKTHVTHH
Quantity
100 μg
Research Discipline
Adaptive Immunity, Immunology
Gene ID (Entrez)
3106
Content And Storage
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Applications
Western Blot
Conjugate
Unconjugated
Formulation
PBS buffer, 2% sucrose
Host Species
Rabbit
Purification Method
Affinity purified
Regulatory Status
RUO
Primary or Secondary
Primary
Target Species
Human
Form
Purified
Related Products
Description
- HLA B Polyclonal specifically detects HLA B in Human samples
- It is validated for Western Blot.
Compare Similar Items
Show Difference
Antigen: HLA B
Classification: Polyclonal
Dilution: Western Blot 1.0 ug/ml
Gene Alias: ankylosing spondylitis, AS, b'DT, Bw-22, Bw-4, Bw-41, Bw-44, Bw-45, Bw-46, Bw-47, Bw-48, Bw-50, Bw-52, Bw-53, Bw-54, Bw-55, Bw-56, Bw-57, Bw-58, Bw-60, HLA class I histocompatibility antigen, B alpha chain, HLA class I histocompatibility antigen, B-12 alpha chain, HLA class I histocompatibility antigen, B-21 alpha chain, HLA class I histocompatibility antigen, B-5 alpha chain, HLA class I histocompatibility antigen, B-7 alpha chain, HLAB, HLA-B27, HLA-B73, leukocyte antigen class I-B, lymphocyte antigen, major histocompatibility complex, class I, B, MGC111087, MHC class I antigen B*13, MHC class I antigen B*14, MHC class I antigen B*15, MHC class I antigen B*18, MHC class I antigen B*27, MHC class I antigen B*35, MHC class I antigen B*37, MHC class I antigen B*38, MHC class I antigen B*39, MHC class I antigen B*40, MHC class I antigen B*41, MHC class I antigen B*42, MHC class I antigen B*44, MHC class I antigen B*45, MHC class I a
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HLA B (XP_011545540.1). Peptide sequence TQRKWEAARVAEQDRAYLEGTCVEWLRRYLENGKDTLERADPPKTHVTHH
Quantity: 100 μg
Research Discipline: Adaptive Immunity, Immunology
Gene ID (Entrez): 3106
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Applications: Western Blot
Conjugate: Unconjugated
Formulation: PBS buffer, 2% sucrose
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Primary or Secondary: Primary
Target Species: Human
Form: Purified
Antigen: HLA B
Classification: Polyclonal
Dilution: Western Blot 1.0 ug/ml
Gene Alias: ankylosing spondylitis, AS, b'DT, Bw-22, Bw-4, Bw-41, Bw-44, Bw-45, Bw-46, Bw-47, Bw-48, Bw-50, Bw-52, Bw-53, Bw-54, Bw-55, Bw-56, Bw-57, Bw-58, Bw-60, HLA class I histocompatibility antigen, B alpha chain, HLA class I histocompatibility antigen, B-12 alpha chain, HLA class I histocompatibility antigen, B-21 alpha chain, HLA class I histocompatibility antigen, B-5 alpha chain, HLA class I histocompatibility antigen, B-7 alpha chain, HLAB, HLA-B27, HLA-B73, leukocyte antigen class I-B, lymphocyte antigen, major histocompatibility complex, class I, B, MGC111087, MHC class I antigen B*13, MHC class I antigen B*14, MHC class I antigen B*15, MHC class I antigen B*18, MHC class I antigen B*27, MHC class I antigen B*35, MHC class I antigen B*37, MHC class I antigen B*38, MHC class I antigen B*39, MHC class I antigen B*40, MHC class I antigen B*41, MHC class I antigen B*42, MHC class I antigen B*44, MHC class I antigen B*45, MHC class I a
Immunogen: The immunogen is a synthetic peptide directed towards the middle terminal region of human HLA B. Peptide sequence VRFDSDATSPRMAPRAPWIEQEGPEYWDRETQISKTNTQTYRENLRTALR
Quantity: 100 μg
Research Discipline: Adaptive Immunity, Immunology
Gene ID (Entrez): 3106
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Applications: Western Blot
Conjugate: Unconjugated
Formulation: PBS buffer, 2% sucrose
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Primary or Secondary: Primary
Target Species: Human
Form: Purified
Antigen: IMP4
Classification: Polyclonal
Dilution: Western Blot 1.0 ug/ml
Gene Alias: Brix domain-containing protein 4, BXDC4MGC19606, IMP4, U3 small nucleolar ribonucleoprotein, homolog (yeast), U3 small nucleolar ribonucleoprotein protein IMP4, U3 snoRNP protein 4 homolog, U3 snoRNP protein IMP4
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human IMP4 (NP_001307233.1). Peptide sequence YKKTDHRNVELTEVGPRFELKLYMIRLGTLEQEATADVEWRWHPYTNTAR
Quantity: 100 μg
Research Discipline: __
Gene ID (Entrez): 92856
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Applications: Western Blot
Conjugate: Unconjugated
Formulation: PBS buffer, 2% sucrose
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Primary or Secondary: Primary
Target Species: Human
Form: Purified
