HLA B Rabbit anti-Human, Polyclonal, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NB125093-Each-of-1 | In Stock | ₹ 41,710.50 |
NB125093 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 41,710.50
GST (18%): ₹ 7,507.89
Total Price: ₹ 49,218.39
Antigen
HLA B
Classification
Polyclonal
Dilution
Western Blot 1.0 ug/ml
Gene Alias
ankylosing spondylitis, AS, b'DT, Bw-22, Bw-4, Bw-41, Bw-44, Bw-45, Bw-46, Bw-47, Bw-48, Bw-50, Bw-52, Bw-53, Bw-54, Bw-55, Bw-56, Bw-57, Bw-58, Bw-60, HLA class I histocompatibility antigen, B alpha chain, HLA class I histocompatibility antigen, B-12 alpha chain, HLA class I histocompatibility antigen, B-21 alpha chain, HLA class I histocompatibility antigen, B-5 alpha chain, HLA class I histocompatibility antigen, B-7 alpha chain, HLAB, HLA-B27, HLA-B73, leukocyte antigen class I-B, lymphocyte antigen, major histocompatibility complex, class I, B, MGC111087, MHC class I antigen B*13, MHC class I antigen B*14, MHC class I antigen B*15, MHC class I antigen B*18, MHC class I antigen B*27, MHC class I antigen B*35, MHC class I antigen B*37, MHC class I antigen B*38, MHC class I antigen B*39, MHC class I antigen B*40, MHC class I antigen B*41, MHC class I antigen B*42, MHC class I antigen B*44, MHC class I antigen B*45, MHC class I a
Immunogen
The immunogen is a synthetic peptide directed towards the middle terminal region of human HLA B. Peptide sequence VRFDSDATSPRMAPRAPWIEQEGPEYWDRETQISKTNTQTYRENLRTALR
Quantity
100 μg
Research Discipline
Adaptive Immunity, Immunology
Gene ID (Entrez)
3106
Content And Storage
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Applications
Western Blot
Conjugate
Unconjugated
Formulation
PBS buffer, 2% sucrose
Host Species
Rabbit
Purification Method
Affinity purified
Regulatory Status
RUO
Primary or Secondary
Primary
Target Species
Human
Form
Purified
Related Products
Description
- HLA B Polyclonal specifically detects HLA B in Human samples
- It is validated for Western Blot.
Compare Similar Items
Show Difference
Antigen: HLA B
Classification: Polyclonal
Dilution: Western Blot 1.0 ug/ml
Gene Alias: ankylosing spondylitis, AS, b'DT, Bw-22, Bw-4, Bw-41, Bw-44, Bw-45, Bw-46, Bw-47, Bw-48, Bw-50, Bw-52, Bw-53, Bw-54, Bw-55, Bw-56, Bw-57, Bw-58, Bw-60, HLA class I histocompatibility antigen, B alpha chain, HLA class I histocompatibility antigen, B-12 alpha chain, HLA class I histocompatibility antigen, B-21 alpha chain, HLA class I histocompatibility antigen, B-5 alpha chain, HLA class I histocompatibility antigen, B-7 alpha chain, HLAB, HLA-B27, HLA-B73, leukocyte antigen class I-B, lymphocyte antigen, major histocompatibility complex, class I, B, MGC111087, MHC class I antigen B*13, MHC class I antigen B*14, MHC class I antigen B*15, MHC class I antigen B*18, MHC class I antigen B*27, MHC class I antigen B*35, MHC class I antigen B*37, MHC class I antigen B*38, MHC class I antigen B*39, MHC class I antigen B*40, MHC class I antigen B*41, MHC class I antigen B*42, MHC class I antigen B*44, MHC class I antigen B*45, MHC class I a
Immunogen: The immunogen is a synthetic peptide directed towards the middle terminal region of human HLA B. Peptide sequence VRFDSDATSPRMAPRAPWIEQEGPEYWDRETQISKTNTQTYRENLRTALR
Quantity: 100 μg
Research Discipline: Adaptive Immunity, Immunology
Gene ID (Entrez): 3106
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Applications: Western Blot
Conjugate: Unconjugated
Formulation: PBS buffer, 2% sucrose
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Primary or Secondary: Primary
Target Species: Human
Form: Purified
Antigen: IMP4
Classification: Polyclonal
Dilution: Western Blot 1.0 ug/ml
Gene Alias: Brix domain-containing protein 4, BXDC4MGC19606, IMP4, U3 small nucleolar ribonucleoprotein, homolog (yeast), U3 small nucleolar ribonucleoprotein protein IMP4, U3 snoRNP protein 4 homolog, U3 snoRNP protein IMP4
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human IMP4 (NP_001307233.1). Peptide sequence YKKTDHRNVELTEVGPRFELKLYMIRLGTLEQEATADVEWRWHPYTNTAR
Quantity: 100 μg
Research Discipline: __
Gene ID (Entrez): 92856
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Applications: Western Blot
Conjugate: Unconjugated
Formulation: PBS buffer, 2% sucrose
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Primary or Secondary: Primary
Target Species: Human
Form: Purified
Antigen: XPB
Classification: Polyclonal
Dilution: Western Blot 1.0 ug/ml
Gene Alias: Basic transcription factor 2 89 kDa subunit, BTF2, BTF2 p89, DNA excision repair protein ERCC-3, DNA repair protein complementing XP-B cells, EC 3.6.1, EC 3.6.4.12, excision repair cross-complementing rodent repair deficiency, complementationgroup 3 (xeroderma pigmentosum group B complementing), GTF2H, RAD25, TFIIH, TFIIH basal transcription factor complex 89 kDa subunit, TFIIH basal transcription factor complex helicase XPB subunit, TFIIH p89, Xeroderma pigmentosum group B-complementing protein, xeroderma pigmentosum, complementation group B, XPBC, XPBTFIIH 89 kDa subunit
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human XPB (NP_000113.1). Peptide sequence KRDRADRDKKKSRKRHYEDEEDDEEDAPGNDPQEAVPSAAGKQVDESGTK
Quantity: 100 μg
Research Discipline: Cancer, DNA Repair, Nucleotide Excision Repair
Gene ID (Entrez): 2071
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Applications: Western Blot
Conjugate: Unconjugated
Formulation: PBS buffer, 2% sucrose
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Primary or Secondary: Primary
Target Species: Human
Form: Purified
