GTPBP9 Antibody, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP157545-Each-of-1 | In Stock | ₹ 41,710.50 |
NBP157545 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 41,710.50
GST (18%): ₹ 7,507.89
Total Price: ₹ 49,218.39
Antigen
GTPBP9
Classification
Polyclonal
Conjugate
Unconjugated
Formulation
PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias
DKFZp313H1942, DNA damage-regulated overexpressed in cancer 45 protein, DOC45, EC 3.6.3, EC 3.6.3.-, GBP45, GTP-binding protein 9, GTP-binding protein 9 (putative), GTP-binding protein PTD004, GTPBP9, homologous yeast-44.2 protein, Obg-like ATPase 1, PTD004
Host Species
Rabbit
Purification Method
Affinity purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Expected identity based on immunogen sequence: Rat: 100%; Human: 100%; Chicken: 100%; Sumatran orangutan: 100%; Bovine: 100%; Mouse: 100%; Endeis laevis: 92%; Nicoletia meinerti: 92%; Skogsbergia lerneri: 92%; Streptocephalus seali: 92%; Brucella sp. 83/13: 92%; Brucella pinnipedialis M292/94/1: 92%; Brucella melitensis bv. 1 str. Rev.1: 92%; Brucella melitensis bv. 3 str. Ether: 92%; Woodlice: 92%; Brine shrimp: 92%; Ammothea hilgendorfi: 92%; Brucella abortus NCTC 8038: 92%; Brucella melitensis bv. 1 str. 16M: 92%; Brucella suis bv. 4 str. 40: 92%; Brucella melitensis bv. 2 str. 63/9: 92%; Brucella suis bv. 5 str. 513: 92%; Brucella suis bv. 3 str. 686: 92%; Brucella sp. F5/99: 92%; Achelia echinata: 92%; Brucella ceti M490/95/1: 92%; Gluconacetobacter hansenii ATCC 23769: 92%; Brucella sp. BO2: 92%; Sphingomonas sp. SKA58: 92%; Brucella abortus: 92%; Gluconobacter suboxydans: 92%; Zymomonas mobilis: 92%; Brucella suis: 92%; Brucella melitensis: 92%; Sinorhizobium meliloti: 92%; Harp
Target Species
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
Isotype
IgG
Applications
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Concentration
0.5 mg/ml
Dilution
Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
Gene Accession No.
Q9NTK5
Gene Symbols
OLA1
Immunogen
Synthetic peptides corresponding to GTPBP9 (GTP-binding protein 9 (putative)) The peptide sequence was selected from the N terminal of GTPBP9. Peptide sequence QGLGNAFLSHISACDGIFHLTRAFEDDDITHVEGSVDPIRDIEIIHEELQ.
Quantity
100 μL
Research Discipline
Proteases & Other Enzymes
Gene ID (Entrez)
29789
Reconstitution
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Related Products
Description
- Description GTPBP9 Polyclonal specifically detects GTPBP9 in Human samples
- It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: GTPBP9
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias: DKFZp313H1942, DNA damage-regulated overexpressed in cancer 45 protein, DOC45, EC 3.6.3, EC 3.6.3.-, GBP45, GTP-binding protein 9, GTP-binding protein 9 (putative), GTP-binding protein PTD004, GTPBP9, homologous yeast-44.2 protein, Obg-like ATPase 1, PTD004
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Expected identity based on immunogen sequence: Rat: 100%; Human: 100%; Chicken: 100%; Sumatran orangutan: 100%; Bovine: 100%; Mouse: 100%; Endeis laevis: 92%; Nicoletia meinerti: 92%; Skogsbergia lerneri: 92%; Streptocephalus seali: 92%; Brucella sp. 83/13: 92%; Brucella pinnipedialis M292/94/1: 92%; Brucella melitensis bv. 1 str. Rev.1: 92%; Brucella melitensis bv. 3 str. Ether: 92%; Woodlice: 92%; Brine shrimp: 92%; Ammothea hilgendorfi: 92%; Brucella abortus NCTC 8038: 92%; Brucella melitensis bv. 1 str. 16M: 92%; Brucella suis bv. 4 str. 40: 92%; Brucella melitensis bv. 2 str. 63/9: 92%; Brucella suis bv. 5 str. 513: 92%; Brucella suis bv. 3 str. 686: 92%; Brucella sp. F5/99: 92%; Achelia echinata: 92%; Brucella ceti M490/95/1: 92%; Gluconacetobacter hansenii ATCC 23769: 92%; Brucella sp. BO2: 92%; Sphingomonas sp. SKA58: 92%; Brucella abortus: 92%; Gluconobacter suboxydans: 92%; Zymomonas mobilis: 92%; Brucella suis: 92%; Brucella melitensis: 92%; Sinorhizobium meliloti: 92%; Harp
Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
Isotype: IgG
Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Concentration: 0.5 mg/ml
Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
Gene Accession No.: Q9NTK5
Gene Symbols: OLA1
Immunogen: Synthetic peptides corresponding to GTPBP9 (GTP-binding protein 9 (putative)) The peptide sequence was selected from the N terminal of GTPBP9. Peptide sequence QGLGNAFLSHISACDGIFHLTRAFEDDDITHVEGSVDPIRDIEIIHEELQ.
Quantity: 100 μL
Research Discipline: Proteases & Other Enzymes
Gene ID (Entrez): 29789
Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Antigen: TNRC6B
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias: KIAA1093trinucleotide repeat-containing gene 6B protein, trinucleotide repeat containing 6B
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Guinea pig: 100%; Equine: 100%; Human: 100%; Rat: 100%; Rabbit: 92%; Chicken: 85%.
Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
Isotype: IgG
Applications: Western Blot
Concentration: 0.5 mg/ml
Dilution: Western Blot 1.0 ug/ml
Gene Accession No.: Q9UPQ9
Gene Symbols: TNRC6B
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TNRC6B. Peptide Sequence FGMGLGNTSR STDAPSQSTG DRKTGSVGSW GAARGPSGTD TVSGQSNSGN. The peptide sequence for this immunogen was taken from within the described region.
Quantity: 100 μL
Research Discipline: __
Gene ID (Entrez): 23112
Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Antigen: RRP7A
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias: BK126B4.3, CGI-96, CTA-126B4.5, Gastric cancer antigen Zg14, MGC150422, MGC150423, ribosomal RNA processing 7 homolog A (S. cerevisiae), ribosomal RNA-processing protein 7 homolog A
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Expected identity based on immunogen sequence: Rat: 100%; Crab-eating macaque: 100%; Human: 100%Sumatran orangutan: 92%; Bovine: 91%; Mouse: 91%; Canine: 83%;.
Target Species: Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig, Rabbit
Isotype: IgG
Applications: Western Blot
Concentration: 0.5 mg/ml
Dilution: Western Blot 1.0 ug/ml
Gene Accession No.: __
Gene Symbols: RRP7A
Immunogen: Synthetic peptides corresponding to CTA-126B4.3(CGI-96 protein) The peptide sequence was selected from the N terminal of CTA-126B4.3. Peptide sequence NVPPYCTEESLSRLLSTCGLVQSVELQEKPDLAESPKESRSKFFHPKPVP.
Quantity: 100 μL
Research Discipline: __
Gene ID (Entrez): 27341
Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
