MUC1 Antibody, Alexa Fluor™ 700, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP16046A70-Each-of-1 | In Stock | ₹ 53,218.32 |
NBP16046A70 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,218.32
GST (18%): ₹ 9,579.298
Total Price: ₹ 62,797.618
Antigen
MUC1
Classification
Polyclonal
Dilution
Western Blot, Flow Cytometry, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin
Gene Alias
Breast carcinoma-associated antigen DF3, Carcinoma-associated mucin, CD227, CD227 antigen, DF3 antigen, EMA, episialin, H23 antigen, H23AG, KL-6, MAM6, MUC-1, MUC1/ZD, mucin 1, cell surface associated, mucin 1, transmembrane, mucin-1, Peanut-reactive urinary mucin, PEMMUC-1/SEC, PEMT, Polymorphic epithelial mucin, PUMMUC-1/X, tumor associated epithelial mucin, Tumor-associated epithelial membrane antigen, Tumor-associated mucin
Host Species
Rabbit
Purification Method
Affinity Purified
Research Discipline
Cancer, Cellular Markers, Extracellular Matrix, Inflammation, Signal Transduction
Gene ID (Entrez)
4582.0
Content And Storage
Store at 4°C in the dark.
Applications
Western Blot, Flow Cytometry, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate
Alexa Fluor 700
Formulation
50 mM sodium borate with 0.05% sodium azide
Gene Symbols
MUC1
Immunogen
Synthetic peptides corresponding to MUC1(mucin 1, cell surface associated) The peptide sequence was selected from the C terminal of MUC1 [NP_001037855]. Peptide sequence GQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSL.
Quantity
0.1 mL
Primary or Secondary
Primary
Target Species
Human, Mouse, Rat, Porcine, Bovine, Equine, Guinea Pig, Goat, Rabbit
Isotype
IgG
Related Products
Description
- MUC1 Polyclonal specifically detects MUC1 in Human, Mouse, Rat, Porcine, Bovine, Equine, Guinea Pig, Goat, Rabbit samples
- It is validated for Western Blot, Flow Cytometry, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: MUC1
Classification: Polyclonal
Dilution: Western Blot, Flow Cytometry, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin
Gene Alias: Breast carcinoma-associated antigen DF3, Carcinoma-associated mucin, CD227, CD227 antigen, DF3 antigen, EMA, episialin, H23 antigen, H23AG, KL-6, MAM6, MUC-1, MUC1/ZD, mucin 1, cell surface associated, mucin 1, transmembrane, mucin-1, Peanut-reactive urinary mucin, PEMMUC-1/SEC, PEMT, Polymorphic epithelial mucin, PUMMUC-1/X, tumor associated epithelial mucin, Tumor-associated epithelial membrane antigen, Tumor-associated mucin
Host Species: Rabbit
Purification Method: Affinity Purified
Research Discipline: Cancer, Cellular Markers, Extracellular Matrix, Inflammation, Signal Transduction
Gene ID (Entrez): 4582.0
Content And Storage: Store at 4°C in the dark.
Applications: Western Blot, Flow Cytometry, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Alexa Fluor 700
Formulation: 50 mM sodium borate with 0.05% sodium azide
Gene Symbols: MUC1
Immunogen: Synthetic peptides corresponding to MUC1(mucin 1, cell surface associated) The peptide sequence was selected from the C terminal of MUC1 [NP_001037855]. Peptide sequence GQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSL.
Quantity: 0.1 mL
Primary or Secondary: Primary
Target Species: Human, Mouse, Rat, Porcine, Bovine, Equine, Guinea Pig, Goat, Rabbit
Isotype: IgG
Antigen: Neurochondrin
Classification: Polyclonal
Dilution: Western Blot > 1:500, ELISA < 1:10000, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunoprecipitation 1:200, Immunohistochemistry-Paraffin 1:100
Gene Alias: KIAA0607NCDN-1, NCDN-2, neurochondrin
Host Species: Rabbit
Purification Method: __
Research Discipline: __
Gene ID (Entrez): 23154
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
Applications: Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunoprecipitation, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: Tris/Glycine buffer pH 7.5-7.9, stabilizing protein, and glycerol with 0.02% sodium azide
Gene Symbols: NCDN
Immunogen: Synthetic peptides corresponding to unique epitope on NORB with peptide sequcne corresponding to (EETASHYRMAALEQCLSEP). The NORB peptide was covalently modified post-synthetically to achieve desired antigenicity.
Quantity: 0.05 mg
Primary or Secondary: Primary
Target Species: Human, Mouse, Rat
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Alias: __
Host Species: __
Purification Method: Affinity purified
Research Discipline: __
Gene ID (Entrez): 23154
Content And Storage: -80°C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: __
Gene Symbols: __
Immunogen: __
Quantity: 0.25 mg
Primary or Secondary: __
Target Species: __
Isotype: __
