CSRP3 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP213880-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP213880 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
CSRP3
Classification
Polyclonal
Dilution
Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
Gene Alias
Cardiac LIM protein, CLPMGC14488, CMD1Mcardiac LIM domain protein, CMH12, CRP3cysteine and glycine-rich protein 3, cysteine and glycine-rich protein 3 (cardiac LIM protein), Cysteine-rich protein 3, LIM domain only 4, LIM domain protein, cardiac, LMO4, MLPMGC61993, Muscle LIM protein
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols
CSRP3
Immunogen
This antibody was developed against a recombinant protein corresponding to the amino acids: GAGCLSTDTGEHLGLQFQQSPKPARSVTTSNPSKFTAKFGESEKCPRCGKSVYA
Quantity
0.1 mL
Research Discipline
DNA Repair, DNA replication Transcription Translation and Splicing
Gene ID (Entrez)
8048
Target Species
Human
Isotype
IgG
Related Products
Description
- CSRP3 Polyclonal specifically detects CSRP3 in Human samples
- It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: CSRP3
Classification: Polyclonal
Dilution: Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
Gene Alias: Cardiac LIM protein, CLPMGC14488, CMD1Mcardiac LIM domain protein, CMH12, CRP3cysteine and glycine-rich protein 3, cysteine and glycine-rich protein 3 (cardiac LIM protein), Cysteine-rich protein 3, LIM domain only 4, LIM domain protein, cardiac, LMO4, MLPMGC61993, Muscle LIM protein
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols: CSRP3
Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: GAGCLSTDTGEHLGLQFQQSPKPARSVTTSNPSKFTAKFGESEKCPRCGKSVYA
Quantity: 0.1 mL
Research Discipline: DNA Repair, DNA replication Transcription Translation and Splicing
Gene ID (Entrez): 8048
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Alias: __
Host Species: __
Purification Method: Chromatography
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: GAGCLSTDTGEHLGLQFQQSPKPARSVTTSNPSKFTAKFGESEKCPRCGKSVYA
Quantity: 0.1mL
Research Discipline: __
Gene ID (Entrez): 8048
Target Species: __
Isotype: __
Antigen: Cystatin F
Classification: Polyclonal
Dilution: Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200-1:500
Gene Alias: CMAP, cystatin F (leukocystatin), Cystatin-7, cystatin-F, Cystatin-like metastasis-associated protein, leukocystatin
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols: CST7
Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: VKGLKYMLEVEIGRTTCKKNQHLRLDDCDFQTNHTLKQTLSCYSEVWVVPWLQHFEVPVLRCH
Quantity: 0.1 mL
Research Discipline: __
Gene ID (Entrez): 8530
Target Species: Human
Isotype: IgG