Pit1 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP255357-Each-of-1 | In Stock | ₹ 55,271.76 |
NBP255357 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 55,271.76
GST (18%): ₹ 9,948.917
Total Price: ₹ 65,220.677
Antigen
Pit1
Classification
Polyclonal
Dilution
Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
Gene Alias
CPHD1, GHF1, GHF-1pituitary-specific positive transcription factor 1, Growth hormone factor 1, PIT-1, PIT1pituitary-specific transcription factor 1, POU class 1 homeobox 1, POU domain class 1, transcription factor 1, POU domain, class 1, transcription factor 1, POU1F1a
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
POU1F1
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:FPDHTLSHGFPPIHQPLLAEDPTAADFKQELRRKSKLVEEPIDMDSPEIRELEKFANEFKVRRIKLGYTQTNVGEALAAVHGS
Quantity
100 μL
Research Discipline
Breast Cancer, Cell Cycle and Replication
Gene ID (Entrez)
5449
Target Species
Human
Isotype
IgG
Related Products
Description
- Pit1 Polyclonal specifically detects Pit1 in Human samples
- It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: Pit1
Classification: Polyclonal
Dilution: Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
Gene Alias: CPHD1, GHF1, GHF-1pituitary-specific positive transcription factor 1, Growth hormone factor 1, PIT-1, PIT1pituitary-specific transcription factor 1, POU class 1 homeobox 1, POU domain class 1, transcription factor 1, POU domain, class 1, transcription factor 1, POU1F1a
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: POU1F1
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:FPDHTLSHGFPPIHQPLLAEDPTAADFKQELRRKSKLVEEPIDMDSPEIRELEKFANEFKVRRIKLGYTQTNVGEALAAVHGS
Quantity: 100 μL
Research Discipline: Breast Cancer, Cell Cycle and Replication
Gene ID (Entrez): 5449
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Alias: CPHD1, GHF1, GHF-1pituitary-specific positive transcription factor 1, Growth hormone factor 1, PIT-1, PIT1pituitary-specific transcription factor 1, POU class 1 homeobox 1, POU domain class 1, transcription factor 1, POU domain, class 1, transcription fac
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Research Discipline: __
Gene ID (Entrez): 5449
Target Species: __
Isotype: __
Antigen: Septin-9
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: AF17q25, FLJ75490, KIAA0991Ov/Br septin, MLL septin-like fusion protein, MLL septin-like fusion protein MSF-A, MSF1NAPB, MSFMLL septin-like fusion, Ovarian/Breast septin, PNUTL4, SeptD1, septin 9, Septin D1, septin-9, SINT1
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: 43352
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PAPVSQLQSRLEPKPQPPVAEATPRSQEATEAAPSCVGDMADTPRDAGLKQAPASRNEKAPVDFGYVGIDS
Quantity: 100 μL
Research Discipline: Cell Cycle and Replication
Gene ID (Entrez): 10801
Target Species: Human
Isotype: IgG