POU5F1P1 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP255475-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP255475 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
POU5F1P1
Classification
Polyclonal
Dilution
Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias
OCT4-PG1, Octamer-binding protein 3-like, Octamer-binding transcription factor 3-like, OTF3Coctamer binding protein 3_like sequence, OTF3P1, POU 5 domain protein, POU class 5 homeobox 1 pseudogene 1, POU class 5 homeobox 1B, POU domain class 5, transcription factor 1 pseudogene 1, POU domain transcription factor Oct-4, POU domain transcription factor OCT4-pg1, POU domain, class 5, transcription factor 1 pseudogene 1, POU5F1P1, POU5F1P4, POU5FLC20, POU5FLC8, putative POU domain, class 5, transcription factor 1B
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Gene ID (Entrez)
5462
Target Species
Human
Isotype
IgG
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
POU5F1B
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:VGPGSEVWGIPPCPPPYELCGGMAYCGPQVGVGLVPQGGLETSQPESEAGV
Quantity
100 μL
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Related Products
Description
- POU5F1P1 Polyclonal specifically detects POU5F1P1 in Human samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: POU5F1P1
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: OCT4-PG1, Octamer-binding protein 3-like, Octamer-binding transcription factor 3-like, OTF3Coctamer binding protein 3_like sequence, OTF3P1, POU 5 domain protein, POU class 5 homeobox 1 pseudogene 1, POU class 5 homeobox 1B, POU domain class 5, transcription factor 1 pseudogene 1, POU domain transcription factor Oct-4, POU domain transcription factor OCT4-pg1, POU domain, class 5, transcription factor 1 pseudogene 1, POU5F1P1, POU5F1P4, POU5FLC20, POU5FLC8, putative POU domain, class 5, transcription factor 1B
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 5462
Target Species: Human
Isotype: IgG
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: POU5F1B
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:VGPGSEVWGIPPCPPPYELCGGMAYCGPQVGVGLVPQGGLETSQPESEAGV
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: __
Classification: __
Dilution: __
Gene Alias: OCT4-PG1, Octamer-binding protein 3-like, Octamer-binding transcription factor 3-like, OTF3Coctamer binding protein 3_like sequence, OTF3P1, POU 5 domain protein, POU class 5 homeobox 1 pseudogene 1, POU class 5 homeobox 1B, POU domain class 5, transcript
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Gene ID (Entrez): 5462
Target Species: __
Isotype: __
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
Antigen: C1orf51
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: BC017397, chromosome 1 open reading frame 51, FLJ25889, hypothetical protein LOC148523
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 148523
Target Species: Human
Isotype: IgG
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: C1ORF51
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SLGGGKHQLTKHFPSHHSDSAASSPASPMEKMDQTQLGHLALKPKQPWHLTQWPAMNLTWIHTTPICNPPLSSPGTISFSHGPLGTGTGI
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
