hnRNP A2B1 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP256497-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP256497 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
hnRNP A2B1
Classification
Polyclonal
Dilution
Western Blot 0.04-0.4 ug/ml, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Knockout Validated, KnockDown Validated
Gene Alias
DKFZp779B0244, FLJ22720, heterogeneous nuclear ribonucleoprotein A2/B1, heterogeneous nuclear ribonucleoprotein B1, heterogeneous nuclear ribonucleoproteins A2/B1, hnRNP A2 hnRNP B1, HNRNPA2, HNRNPB1, HNRPA2, HNRPA2B1hnRNP A2/B1, HNRPB1, nuclear ribonucleoprotein particle A2 protein, RNPA2, SNRPB1
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Western Blot, Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
HNRNPA2B1
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:RQEMQEVQSSRSGRGGNFGFGDSRG
Quantity
100 μL
Research Discipline
Cancer, DNA Repair, DNA replication Transcription Translation and Splicing
Gene ID (Entrez)
3181
Target Species
Human
Isotype
IgG
Related Products
Description
- hnRNP A2B1 Polyclonal specifically detects hnRNP A2B1 in Human samples
- It is validated for Western Blot, Immunocytochemistry/Immunofluorescence, Knockdown Validated.
Compare Similar Items
Show Difference
Antigen: hnRNP A2B1
Classification: Polyclonal
Dilution: Western Blot 0.04-0.4 ug/ml, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Knockout Validated, KnockDown Validated
Gene Alias: DKFZp779B0244, FLJ22720, heterogeneous nuclear ribonucleoprotein A2/B1, heterogeneous nuclear ribonucleoprotein B1, heterogeneous nuclear ribonucleoproteins A2/B1, hnRNP A2 hnRNP B1, HNRNPA2, HNRNPB1, HNRPA2, HNRPA2B1hnRNP A2/B1, HNRPB1, nuclear ribonucleoprotein particle A2 protein, RNPA2, SNRPB1
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Western Blot, Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: HNRNPA2B1
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:RQEMQEVQSSRSGRGGNFGFGDSRG
Quantity: 100 μL
Research Discipline: Cancer, DNA Repair, DNA replication Transcription Translation and Splicing
Gene ID (Entrez): 3181
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Alias: DKFZp779B0244, FLJ22720, heterogeneous nuclear ribonucleoprotein A2/B1, heterogeneous nuclear ribonucleoprotein B1, heterogeneous nuclear ribonucleoproteins A2/B1, hnRNP A2 hnRNP B1, HNRNPA2, HNRNPB1, HNRPA2, HNRPA2B1hnRNP A2/B1, HNRPB1, nuclear ribonucleoprotein particle A2 protein, RNPA2, SNRPB1
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Research Discipline: __
Gene ID (Entrez): 3181
Target Species: __
Isotype: __
Antigen: PLAGL1
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: DKFZp781P1017, LOT-1, LOT1ZACLost on transformation 1, MGC126275, MGC126276, PLAG-like 1, pleiomorphic adenoma gene-like 1, pleiomorphic adenoma gene-like protein 1, Pleiomorphic adenoma-like protein 1, Tumor supressor ZAC, ZAC tumor supressor, ZAC1, zinc finger protein PLAGL1
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: PLAGL1
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:QELMKESLQTGDLLSTFHTISPSFQLKAAALPPFPLGASAQNGLASSLPAEVHSLTLSPPEQAAQPMQPLPESLASLHPSVSPGSP
Quantity: 100 μL
Research Discipline: Apoptosis, Neuronal Stem Cell Markers, Stem Cell Markers
Gene ID (Entrez): 5325
Target Species: Human
Isotype: IgG