PIP5K2B Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP256946-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP256946 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
PIP5K2B
Classification
Polyclonal
Dilution
Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias
1-phosphatidylinositol-4-phosphate kinase, 1-phosphatidylinositol-5-phosphate 4-kinase 2-beta, Diphosphoinositide kinase 2-beta, EC 2.7.1, EC 2.7.1.149, phosphatidylinositol-4-phosphate 5-kinase, type II, beta, Phosphatidylinositol-5-phosphate 4-kinase type II beta, phosphatidylinositol-5-phosphate 4-kinase type-2 beta, phosphatidylinositol-5-phosphate 4-kinase, type II, beta, PI(5)P 4-kinase type II beta, PI5P4KB, PIP4KII-beta, PIP5K2B, PIP5KIIB, PIP5KIIbeta, PTDINS(4)P-5-kinase, PtdIns(5)P-4-kinase isoform 2-beta
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Western Blot, Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
PIP4K2B
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PDSPGNLLSFPRFFGPGEFDPSVDVYAMKSH
Quantity
100 μL
Research Discipline
Cancer
Gene ID (Entrez)
8396
Target Species
Human
Isotype
IgG
Related Products
Description
- PIP5K2B Polyclonal specifically detects PIP5K2B in Human samples
- It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: PIP5K2B
Classification: Polyclonal
Dilution: Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: 1-phosphatidylinositol-4-phosphate kinase, 1-phosphatidylinositol-5-phosphate 4-kinase 2-beta, Diphosphoinositide kinase 2-beta, EC 2.7.1, EC 2.7.1.149, phosphatidylinositol-4-phosphate 5-kinase, type II, beta, Phosphatidylinositol-5-phosphate 4-kinase type II beta, phosphatidylinositol-5-phosphate 4-kinase type-2 beta, phosphatidylinositol-5-phosphate 4-kinase, type II, beta, PI(5)P 4-kinase type II beta, PI5P4KB, PIP4KII-beta, PIP5K2B, PIP5KIIB, PIP5KIIbeta, PTDINS(4)P-5-kinase, PtdIns(5)P-4-kinase isoform 2-beta
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Western Blot, Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: PIP4K2B
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PDSPGNLLSFPRFFGPGEFDPSVDVYAMKSH
Quantity: 100 μL
Research Discipline: Cancer
Gene ID (Entrez): 8396
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Alias: 1-phosphatidylinositol-4-phosphate kinase, 1-phosphatidylinositol-5-phosphate 4-kinase 2-beta, Diphosphoinositide kinase 2-beta, EC 2.7.1, EC 2.7.1.149, phosphatidylinositol-4-phosphate 5-kinase, type II, beta, Phosphatidylinositol-5-phosphate 4-kinase ty
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Research Discipline: __
Gene ID (Entrez): 8396
Target Species: __
Isotype: __
Antigen: Reg3A
Classification: Polyclonal
Dilution: Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Alias: hepatocarcinoma-intestine-pancreas, HIPpancreatitis-associated protein, Human proislet peptide, pancreatic beta cell growth factor, Pancreatitis-associated protein 1, PAP homologous protein, PAP1FLJ18565, PAPPAP-H, PBCGF, proliferation-inducing protein 34, proliferation-inducing protein 42, Reg III-alpha, REG3, REG-3-alpha, regenerating islet-derived 3 alpha, regenerating islet-derived protein 3-alpha, Regenerating islet-derived protein III-alpha, REG-III
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: REG3A
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:YVWIGLHDPTQGTEPNGEGWEWSSSDVMNYFAWERNPSTISSPGHCASLSRSTAFL
Quantity: 100 μL
Research Discipline: __
Gene ID (Entrez): 5068
Target Species: Human
Isotype: IgG