PI 3-Kinase p85 beta Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP256360-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP256360 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
PI 3-Kinase p85 beta
Classification
Polyclonal
Dilution
Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000
Gene Alias
P85B, phosphatidylinositol 3-kinase 85 kDa regulatory subunit beta, phosphatidylinositol 3-kinase regulatory subunit beta, phosphatidylinositol 3-kinase, regulatory subunit, polypeptide 2 (p85 beta), phosphoinositide-3-kinase, regulatory subunit 2 (beta), phosphoinositide-3-kinase, regulatory subunit 2 (p85 beta), phosphoinositide-3-kinase, regulatory subunit, polypeptide 2 (p85 beta), PI3K regulatory subunit beta, PI3-kinase regulatory subunit beta, PI3-kinase subunit p85-beta, ptdIns-3-kinase regulatory subunit beta, ptdIns-3-kinase regulatory subunit p85-beta
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Western Blot, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
PIK3R2
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:EMQRILLNSERLKSRIAEIHESRTKLEQQLRAQASDN
Quantity
100 μL
Research Discipline
Autophagy, Signal Transduction
Gene ID (Entrez)
5296
Target Species
Human
Isotype
IgG
Related Products
Description
- PI 3-Kinase p85 beta Polyclonal specifically detects PI 3-Kinase p85 beta in Human samples
- It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: PI 3-Kinase p85 beta
Classification: Polyclonal
Dilution: Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000
Gene Alias: P85B, phosphatidylinositol 3-kinase 85 kDa regulatory subunit beta, phosphatidylinositol 3-kinase regulatory subunit beta, phosphatidylinositol 3-kinase, regulatory subunit, polypeptide 2 (p85 beta), phosphoinositide-3-kinase, regulatory subunit 2 (beta), phosphoinositide-3-kinase, regulatory subunit 2 (p85 beta), phosphoinositide-3-kinase, regulatory subunit, polypeptide 2 (p85 beta), PI3K regulatory subunit beta, PI3-kinase regulatory subunit beta, PI3-kinase subunit p85-beta, ptdIns-3-kinase regulatory subunit beta, ptdIns-3-kinase regulatory subunit p85-beta
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Western Blot, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: PIK3R2
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:EMQRILLNSERLKSRIAEIHESRTKLEQQLRAQASDN
Quantity: 100 μL
Research Discipline: Autophagy, Signal Transduction
Gene ID (Entrez): 5296
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Alias: chromosome 4 open reading frame 32, FLJ39370
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Research Discipline: __
Gene ID (Entrez): 132720
Target Species: __
Isotype: __
Antigen: Artemis
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: ASCID, DCLREC1C, DNA cross-link repair 1C, DNA cross-link repair 1C protein, EC 3.1, FLJ36438, hSNM1C, protein artemis, Protein A-SCID, PSO2 homolog, RS-SCID, severe combined immunodeficiency, type a (Athabascan), SNM1 homolog C, SNM1CS. cerevisiae), SNM1-like protein
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: DCLRE1C
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:WDSQSDTVLLSSQERNSGDITSLDKADYRPTIKENIPASLMEQNVICPKDTYSDLKSRDKDVTIVPSTGEPTTLS
Quantity: 100 μL
Research Discipline: Cancer, Cell Cycle and Replication, DNA Repair, Non homologous end joining
Gene ID (Entrez): 64421
Target Species: Human
Isotype: IgG
