PIP5K2 alpha Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP256952-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP256952 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
PIP5K2 alpha
Classification
Polyclonal
Dilution
Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias
1-phosphatidylinositol-4-phosphate kinase, 1-phosphatidylinositol-4-phosphate-5-kinase, 1-phosphatidylinositol-5-phosphate 4-kinase 2-alpha, Diphosphoinositide kinase 2-alpha, EC 2.7.1, EC 2.7.1.149, FLJ13267, phosphatidylinositol-4-phosphate 5-kinase, type II, alpha, Phosphatidylinositol-5-phosphate 4-kinase type II alpha, phosphatidylinositol-5-phosphate 4-kinase type-2 alpha, phosphatidylinositol-5-phosphate 4-kinase, type II, alpha, PI(5)P 4-kinase type II alpha, PIP4KII-alpha, PIP5K2, PIP5K2API5P4KA, PIP5KIIA, PIP5KIIalpha, PIP5KII-alpha, PIP5KIII, PIPK, PtdIns(4)P-5-kinase B isoform, PtdIns(4)P-5-kinase C isoform, PtdIns(5)P-4-kinase isoform 2-alpha, type II phosphatidylinositol-4-phosphate 5-kinase 53 K isoform
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Gene ID (Entrez)
5305
Target Species
Human
Isotype
IgG
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
PIP4K2A
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PGNTLNSSPPLAPGEFDPNIDVYGIKCHENSPRKE
Quantity
100 μL
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Related Products
Description
- PIP5K2 alpha Polyclonal specifically detects PIP5K2 alpha in Human samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: PIP5K2 alpha
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: 1-phosphatidylinositol-4-phosphate kinase, 1-phosphatidylinositol-4-phosphate-5-kinase, 1-phosphatidylinositol-5-phosphate 4-kinase 2-alpha, Diphosphoinositide kinase 2-alpha, EC 2.7.1, EC 2.7.1.149, FLJ13267, phosphatidylinositol-4-phosphate 5-kinase, type II, alpha, Phosphatidylinositol-5-phosphate 4-kinase type II alpha, phosphatidylinositol-5-phosphate 4-kinase type-2 alpha, phosphatidylinositol-5-phosphate 4-kinase, type II, alpha, PI(5)P 4-kinase type II alpha, PIP4KII-alpha, PIP5K2, PIP5K2API5P4KA, PIP5KIIA, PIP5KIIalpha, PIP5KII-alpha, PIP5KIII, PIPK, PtdIns(4)P-5-kinase B isoform, PtdIns(4)P-5-kinase C isoform, PtdIns(5)P-4-kinase isoform 2-alpha, type II phosphatidylinositol-4-phosphate 5-kinase 53 K isoform
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 5305
Target Species: Human
Isotype: IgG
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: PIP4K2A
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PGNTLNSSPPLAPGEFDPNIDVYGIKCHENSPRKE
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: KIAA1161
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: EC 3.2.1.-, hypothetical protein LOC57462, KIAA1161, NET37
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 57462
Target Species: Human
Isotype: IgG
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: KIAA1161
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:DSVPFHLGWNSTERSLRLQARYHDTPYKPPAGRAAAPELSYRVCVGSDVTSIHKYMVRRYFNKPSRVPAPEAFRDPIW
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: __
Classification: __
Dilution: __
Gene Alias: EC 3.2.1.-, hypothetical protein LOC57462, KIAA1161, NET37
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Gene ID (Entrez): 57462
Target Species: __
Isotype: __
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.