GRK2 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP257283-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP257283 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
GRK2
Classification
Polyclonal
Dilution
Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias
adrenergic, beta, receptor kinase 1, BARK, BARK1beta-ARK-1, Beta-ARK-1, BETA-ARK1, EC 2.7.11, EC 2.7.11.15, FLJ16718, G-protein coupled receptor kinase 2, GRK2beta-adrenergic receptor kinase 1
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
GRK2
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LVQWKKELRDAYREAQQLVQRVPKMKNKPRSPVVELSKVPLVQRGSANGL
Quantity
100 μL
Research Discipline
Cancer, Cellular Markers, Mitochondrial Markers, Neuroscience, Protein Kinase, Signal Transduction
Gene ID (Entrez)
156
Target Species
Human
Isotype
IgG
Related Products
Description
- Description GRK2 Polyclonal specifically detects GRK2 in Human samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: GRK2
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: adrenergic, beta, receptor kinase 1, BARK, BARK1beta-ARK-1, Beta-ARK-1, BETA-ARK1, EC 2.7.11, EC 2.7.11.15, FLJ16718, G-protein coupled receptor kinase 2, GRK2beta-adrenergic receptor kinase 1
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: GRK2
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LVQWKKELRDAYREAQQLVQRVPKMKNKPRSPVVELSKVPLVQRGSANGL
Quantity: 100 μL
Research Discipline: Cancer, Cellular Markers, Mitochondrial Markers, Neuroscience, Protein Kinase, Signal Transduction
Gene ID (Entrez): 156
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Alias: adrenergic, beta, receptor kinase 1, BARK, BARK1beta-ARK-1, Beta-ARK-1, BETA-ARK1, EC 2.7.11, EC 2.7.11.15, FLJ16718, G-protein coupled receptor kinase 2, GRK2beta-adrenergic receptor kinase 1
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Research Discipline: __
Gene ID (Entrez): 156
Target Species: __
Isotype: __
Antigen: ROD1
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: DKFZp781I1117, fission yeast differentiation regulator, PTBP3, regulator of differentiation (in S. pombe) 1, regulator of differentiation 1, Rod1, ROD1 regulator of differentiation 1 (S. pombe)
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: PTBP3
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PAIGFPQATGLSVPAVPGALGPLTITSSAVTGRMAIPGASGIPGN
Quantity: 100 μL
Research Discipline: __
Gene ID (Entrez): 9991
Target Species: Human
Isotype: IgG