PSMB5 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP257323-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP257323 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
PSMB5
Classification
Polyclonal
Dilution
Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias
LMPXproteasome beta 5 subunit, Macropain epsilon chain, MB1EC 3.4.25.1, Multicatalytic endopeptidase complex epsilon chain, proteasome (prosome, macropain) subunit, beta type, 5, proteasome catalytic subunit 3, Proteasome chain 6, Proteasome epsilon chain, proteasome subunit beta type-5, Proteasome subunit MB1, Proteasome subunit X, proteasome subunit, beta type, 5, PSX large multifunctional protease X, XMGC104214
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
PSMB5
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LASVLERPLPVNQRGFFGLGGRADLLDLGPGSLSDGLSLAAPGWGVPEEPGIEMLHGTT
Quantity
100 μL
Research Discipline
Core ESC Like Genes, Stem Cell Markers
Gene ID (Entrez)
5693
Target Species
Human
Isotype
IgG
Related Products
Description
- PSMB5 Polyclonal specifically detects PSMB5 in Human samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: PSMB5
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: LMPXproteasome beta 5 subunit, Macropain epsilon chain, MB1EC 3.4.25.1, Multicatalytic endopeptidase complex epsilon chain, proteasome (prosome, macropain) subunit, beta type, 5, proteasome catalytic subunit 3, Proteasome chain 6, Proteasome epsilon chain, proteasome subunit beta type-5, Proteasome subunit MB1, Proteasome subunit X, proteasome subunit, beta type, 5, PSX large multifunctional protease X, XMGC104214
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: PSMB5
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LASVLERPLPVNQRGFFGLGGRADLLDLGPGSLSDGLSLAAPGWGVPEEPGIEMLHGTT
Quantity: 100 μL
Research Discipline: Core ESC Like Genes, Stem Cell Markers
Gene ID (Entrez): 5693
Target Species: Human
Isotype: IgG
Antigen: KIAA1143
Classification: Polyclonal
Dilution: Western Blot 1:100 - 1:250, Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: hypothetical protein LOC57456, KIAA1143
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Western Blot, Immunocytochemistry, Immunofluorescence, KnockDown
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: KIAA1143
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MSKRNQVSYVRPAEPAFLARFKERVGYREGPTVETKRIQPQP
Quantity: 100 μL
Research Discipline: __
Gene ID (Entrez): 57456
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Alias: hypothetical protein LOC57456, KIAA1143
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Research Discipline: __
Gene ID (Entrez): 57456
Target Species: __
Isotype: __
