PI 3-Kinase p55 gamma Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP257974-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP257974 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
PIK3R3
Classification
Polyclonal
Dilution
Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias
100% homology to SWISS-PROT Q92569, DKFZp686P05226, FLJ41892, p55, Phosphatidylinositol 3-kinase 55 kDa regulatory subunit gamma, phosphoinositide-3-kinase, regulatory subunit 3 (gamma), phosphoinositide-3-kinase, regulatory subunit 3 (p55, gamma), phosphoinositide-3-kinase, regulatory subunit, polypeptide 3 (p55, gamma), PI3K regulatory subunit gamma, PI3-kinase subunit p55-gamma, regulatory subunit, polypeptide 3 (p55, gamma)
Host Species
Rabbit
Molecular Weight of Antigen
54 kDa
Quantity
100 μL
Research Discipline
Cancer, Diabetes Research, mTOR Pathway, Neuroscience, Signal Transduction
Gene ID (Entrez)
8503
Target Species
Human
Isotype
IgG
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
PIK3R3
Immunogen
PI 3-Kinase p55 gamma Antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MYNTVWSMDRDDADWREVMMPYSTELIFYIEMD
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Related Products
Description
- PI 3-Kinase p55 gamma Polyclonal specifically detects PI 3-Kinase p55 gamma in Human samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: PIK3R3
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: 100% homology to SWISS-PROT Q92569, DKFZp686P05226, FLJ41892, p55, Phosphatidylinositol 3-kinase 55 kDa regulatory subunit gamma, phosphoinositide-3-kinase, regulatory subunit 3 (gamma), phosphoinositide-3-kinase, regulatory subunit 3 (p55, gamma), phosphoinositide-3-kinase, regulatory subunit, polypeptide 3 (p55, gamma), PI3K regulatory subunit gamma, PI3-kinase subunit p55-gamma, regulatory subunit, polypeptide 3 (p55, gamma)
Host Species: Rabbit
Molecular Weight of Antigen: 54 kDa
Quantity: 100 μL
Research Discipline: Cancer, Diabetes Research, mTOR Pathway, Neuroscience, Signal Transduction
Gene ID (Entrez): 8503
Target Species: Human
Isotype: IgG
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: PIK3R3
Immunogen: PI 3-Kinase p55 gamma Antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MYNTVWSMDRDDADWREVMMPYSTELIFYIEMD
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: __
Classification: __
Dilution: __
Gene Alias: 100% homology to SWISS-PROT Q92569, DKFZp686P05226, FLJ41892, p55, Phosphatidylinositol 3-kinase 55 kDa regulatory subunit gamma, phosphoinositide-3-kinase, regulatory subunit 3 (gamma), phosphoinositide-3-kinase, regulatory subunit 3 (p55, gamma), phosph
Host Species: __
Molecular Weight of Antigen: __
Quantity: 100μL
Research Discipline: __
Gene ID (Entrez): 8503
Target Species: __
Isotype: __
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4
Gene Symbols: __
Immunogen: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
Antigen: __
Classification: __
Dilution: __
Gene Alias: ABRI, ABri/ADan amyloid peptide, BRI2, BRICD2B, BRICHOS domain containing 2B, BRIFBD, E25B, E3-16, integral membrane protein 2B, Protein E25B, Transmembrane protein BRI
Host Species: __
Molecular Weight of Antigen: __
Quantity: 100μL
Research Discipline: __
Gene ID (Entrez): 9445
Target Species: __
Isotype: __
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4
Gene Symbols: __
Immunogen: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
