MCM3AP Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP258502-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP258502 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
MCM3AP
Classification
Polyclonal
Dilution
Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias
80 kDa MCM3-associated protein, FLJ44336, GANPFLJ45306, human mRNA for MCM3 import factor10Protein GANP, KIAA0572MAP80germinal center-associated nuclear protein, Map80, MCM3 import protein, MCM3 minichromosome maintenance deficient 3 (S. cerevisiae) associated protein, MCM3 minichromosome maintenance deficient 3 associated protein, minichromosome maintenance complex component 3 associated protein, minichromosome maintenance deficient (S. cerevisiae) 3-associated protein, minichromosome maintenance deficient 3-associated protein
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Gene ID (Entrez)
8888
Target Species
Human
Isotype
IgG
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
MCM3AP
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:RDWYDFVWNRTRGIRKDITQQHLCDPLTVSLIEKCTRFHIHCAHFMCEEPMSSFDAKINNENMTKCLQSLKEMYQDLRNKGVFCASE
Quantity
100 μL
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Related Products
Description
- Description MCM3AP Polyclonal specifically detects MCM3AP in Human samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: MCM3AP
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: 80 kDa MCM3-associated protein, FLJ44336, GANPFLJ45306, human mRNA for MCM3 import factor10Protein GANP, KIAA0572MAP80germinal center-associated nuclear protein, Map80, MCM3 import protein, MCM3 minichromosome maintenance deficient 3 (S. cerevisiae) associated protein, MCM3 minichromosome maintenance deficient 3 associated protein, minichromosome maintenance complex component 3 associated protein, minichromosome maintenance deficient (S. cerevisiae) 3-associated protein, minichromosome maintenance deficient 3-associated protein
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 8888
Target Species: Human
Isotype: IgG
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: MCM3AP
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:RDWYDFVWNRTRGIRKDITQQHLCDPLTVSLIEKCTRFHIHCAHFMCEEPMSSFDAKINNENMTKCLQSLKEMYQDLRNKGVFCASE
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: __
Classification: __
Dilution: __
Gene Alias: 80 kDa MCM3-associated protein, FLJ44336, GANPFLJ45306, human mRNA for MCM3 import factor10Protein GANP, KIAA0572MAP80germinal center-associated nuclear protein, Map80, MCM3 import protein, MCM3 minichromosome maintenance deficient 3 (S. cerevisiae) assoc
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Gene ID (Entrez): 8888
Target Species: __
Isotype: __
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
Antigen: TOX2
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: C20orf100, chromosome 20 open reading frame 100, dJ495O3.1, GCX1, GCX-1dJ1108D11.2, granulosa cell HMG box 1, Granulosa cell HMG box protein 1, granulosa cell HMG-box protein 1, MGC15880, TOX high mobility group box family member 2
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 84969
Target Species: Human
Isotype: IgG
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: TOX2
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:HEASYHSLCHGLTPNGLLPAYSYQAMDLPAIMVSNMLAQDSHLLSGQLPTIQEMVHSEVAAYDSGR
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.