RACK1 Polyclonal Antibody, Invitrogen™
Manufacturer: Thermo Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | PIPA579319-Each-of-1 | In Stock | ₹ 41,796.06 |
PIPA579319 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 41,796.06
GST (18%): ₹ 7,523.291
Total Price: ₹ 49,319.351
Antigen
RACK1
Classification
Polyclonal
Conjugate
Unconjugated
Gene
RACK1
Gene Alias
12-3; activated protein kinase C receptor; AL033335; Cell proliferation-inducing gene 21 protein; CG7111; CG7111-PA; CG7111-PB; CG7111-PC; CG7111-PD; Dmel\CG7111; Dmel_CG7111; dRack1; GB-like; gnb2l1; Gnb2-rs1; guanine nucleotide binding protein (G protein) beta polypeptide 2-like 1; guanine nucleotide binding protein (G protein), beta polypeptide 2 like 1; guanine nucleotide binding protein (G protein), beta polypeptide 2 like 1 sequence 1; guanine nucleotide binding protein (G protein), beta polypeptide 2-like 1; guanine nucleotide binding protein beta polypeptide 2-like 1; guanine nucleotide binding protein related; guanine nucleotide binding protein, beta 2, related sequence 1; guanine nucleotide binding protein, beta polypeptide 2-like 1; guanine nucleotide binding protein, beta-2, related sequence 1; guanine nucleotide-binding protein beta-subunit like protein; guanine nucleotide-binding protein subunit beta-2-like 1; Guanine nucleotide-binding protein subunit beta-2-like 1, N-terminally processed; Guanine nucleotide-binding protein subunit beta-like protein; Guanine nucleotide-binding protein subunit beta-like protein 12.3; H12.3; HLC7; HLC-7; Human lung cancer oncogene 7 protein; i173; lung cancer oncogene 7; OTTHUMP00000223870; OTTHUMP00000223891; OTTHUMP00000223893; OTTHUMP00000223900; OTTHUMP00000223901; OTTHUMP00000223902; OTTHUMP00000223930; OTTHUMP00000223931; p205; PIG21; proliferation-inducing gene 21; protein homologous to chicken B complex protein, guanine nucleotide binding; protein kinase C receptor; RACK; Rack1; rack-1; Rack1-PA; Rack1-PB; Rack1-PC; Rack1-PD; RE74715p; receptor for activated C kinase; receptor for activated C kinase 1; receptor for activated protein kinase C; receptor for activated protein kinase C1; receptor of activated PKC; receptor of activated protein C kinase 1; Receptor of activated protein C kinase 1, N-terminally processed; Receptor of activated protein kinase C; receptor of activated protein kinase C 1; Receptor of activated protein kinase C homolog; similar to mammalian RACK1; Small ribosomal subunit protein RACK1; wu:fb80d08; wu:fk65d12
Host Species
Rabbit
Purification Method
Antigen affinity chromatography
Regulatory Status
RUO
Gene ID (Entrez)
10399, 14694, 83427
Content And Storage
-20°C
Form
Lyophilized
Applications
Flow Cytometry, Immunocytochemistry, Western Blot
Concentration
500 μg/mL
Formulation
PBS with 4MG trehalose and 0.05MG sodium azide
Gene Accession No.
P63244, P63245, P68040
Gene Symbols
RACK1
Immunogen
E.coli-derived human RACK1 recombinant protein (Position: T2-R317).
Quantity
100 μg
Primary or Secondary
Primary
Target Species
Human, Mouse, Rat
Product Type
Antibody
Isotype
IgG
Related Products
Description
- Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL
- RACK1 (receptor for activated C kinase 1) was identified through its binding to various PKC isoforms
- Its main function is to recruit PKC and various other proteins to specific locations to form multiprotein complexes, mediating various signal pathways
- RACK1 is required for VANGL2 membrane localization and for PTK2/FAK1 phosphorylation and dephosphorylation.
Compare Similar Items
Show Difference
Antigen: RACK1
Classification: Polyclonal
Conjugate: Unconjugated
Gene: RACK1
Gene Alias: 12-3; activated protein kinase C receptor; AL033335; Cell proliferation-inducing gene 21 protein; CG7111; CG7111-PA; CG7111-PB; CG7111-PC; CG7111-PD; Dmel\CG7111; Dmel_CG7111; dRack1; GB-like; gnb2l1; Gnb2-rs1; guanine nucleotide binding protein (G protein) beta polypeptide 2-like 1; guanine nucleotide binding protein (G protein), beta polypeptide 2 like 1; guanine nucleotide binding protein (G protein), beta polypeptide 2 like 1 sequence 1; guanine nucleotide binding protein (G protein), beta polypeptide 2-like 1; guanine nucleotide binding protein beta polypeptide 2-like 1; guanine nucleotide binding protein related; guanine nucleotide binding protein, beta 2, related sequence 1; guanine nucleotide binding protein, beta polypeptide 2-like 1; guanine nucleotide binding protein, beta-2, related sequence 1; guanine nucleotide-binding protein beta-subunit like protein; guanine nucleotide-binding protein subunit beta-2-like 1; Guanine nucleotide-binding protein subunit beta-2-like 1, N-terminally processed; Guanine nucleotide-binding protein subunit beta-like protein; Guanine nucleotide-binding protein subunit beta-like protein 12.3; H12.3; HLC7; HLC-7; Human lung cancer oncogene 7 protein; i173; lung cancer oncogene 7; OTTHUMP00000223870; OTTHUMP00000223891; OTTHUMP00000223893; OTTHUMP00000223900; OTTHUMP00000223901; OTTHUMP00000223902; OTTHUMP00000223930; OTTHUMP00000223931; p205; PIG21; proliferation-inducing gene 21; protein homologous to chicken B complex protein, guanine nucleotide binding; protein kinase C receptor; RACK; Rack1; rack-1; Rack1-PA; Rack1-PB; Rack1-PC; Rack1-PD; RE74715p; receptor for activated C kinase; receptor for activated C kinase 1; receptor for activated protein kinase C; receptor for activated protein kinase C1; receptor of activated PKC; receptor of activated protein C kinase 1; Receptor of activated protein C kinase 1, N-terminally processed; Receptor of activated protein kinase C; receptor of activated protein kinase C 1; Receptor of activated protein kinase C homolog; similar to mammalian RACK1; Small ribosomal subunit protein RACK1; wu:fb80d08; wu:fk65d12
Host Species: Rabbit
Purification Method: Antigen affinity chromatography
Regulatory Status: RUO
Gene ID (Entrez): 10399, 14694, 83427
Content And Storage: -20°C
Form: Lyophilized
Applications: Flow Cytometry, Immunocytochemistry, Western Blot
Concentration: 500 μg/mL
Formulation: PBS with 4MG trehalose and 0.05MG sodium azide
Gene Accession No.: P63244, P63245, P68040
Gene Symbols: RACK1
Immunogen: E.coli-derived human RACK1 recombinant protein (Position: T2-R317).
Quantity: 100 μg
Primary or Secondary: Primary
Target Species: Human, Mouse, Rat
Product Type: Antibody
Isotype: IgG
Antigen: GRB7
Classification: Polyclonal
Conjugate: Unconjugated
Gene: GRB7
Gene Alias: B47; Epidermal growth factor receptor GRB-7; Grb7; GRB7 adapter protein; growth factor receptor binding protein GRB7; growth factor receptor bound protein 7; growth factor receptor-bound protein 7; Growth factor receptor-bound protein 7 (GRB7 adapter protein) (Epidermal growth factor receptor GRB-7); mKIAA4028; OTTHUMP00000164352
Host Species: Rabbit
Purification Method: Antigen affinity chromatography
Regulatory Status: RUO
Gene ID (Entrez): 14786, 2886, 84427
Content And Storage: -20°C
Form: Lyophilized
Applications: Immunohistochemistry (Paraffin), Western Blot
Concentration: 500 μg/mL
Formulation: PBS with 5MG BSA and 0.05MG sodium azide, 0.05MG thimerosal
Gene Accession No.: Q03160, Q14451, Q9QZC5
Gene Symbols: GRB7
Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human GRB7 (124-141aa ARHVCEMLVQRAHALSDE).
Quantity: 100 μg
Primary or Secondary: Primary
Target Species: Human, Mouse, Rat
Product Type: Antibody
Isotype: IgG
Antigen: GREM1
Classification: Polyclonal
Conjugate: Unconjugated
Gene: Grem1
Gene Alias: C15DUPq; Cell proliferation-inducing gene 2 protein; CKTSF1B1; colorectal adenoma and carcinoma 1; CRAC1; CRCS4; Cysteine knot superfamily 1, BMP antagonist 1; DAN domain family member 2; DAND2; Down-regulated in Mos-transformed cells protein; down-regulated in v-mos-transformed cells; Drm; DUP15q; Grem; GREM1; gremlin; gremlin 1; gremlin 1 homolog, cysteine knot superfamily; gremlin 1, cysteine knot superfamily, homolog; gremlin 1, DAN family BMP antagonist; gremlin 1-like protein; gremlin-1; HMPS; HMPS1; IHG-2; Increased in high glucose protein 2; increased in high glucose-2; ld; MPSH; PIG2
Host Species: Rabbit
Purification Method: Antigen affinity chromatography
Regulatory Status: RUO
Gene ID (Entrez): 26585, 50566
Content And Storage: -20°C
Form: Lyophilized
Applications: Western Blot
Concentration: 500 μg/mL
Formulation: PBS with 4MG trehalose and 0.05MG sodium azide
Gene Accession No.: O35793, O60565
Gene Symbols: Grem1
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Gremlin 1 (151-184aa TMMVTLNCPELQPPTKKKRVTRVKQCRCISIDLD).
Quantity: 100 μg
Primary or Secondary: Primary
Target Species: Human, Rat
Product Type: Antibody
Isotype: IgG
