Classification:
Polyclonal
Gene Alias:
1200015F06Rik; 130 kDa myosin-binding subunit of smooth muscle myosin phophatase; 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130); 130 kDa myosin-binding subunit of smooth muscle myosin phosphatase; 130 kDa regulatory subunit of myosin phosphatase; 133kDa myosin-binding subunit of smooth muscle myosin phosphatase (M133); 5730577I22Rik; AA792106; AV099298; D10Ertd625e; hypothetical protein; I79_016312; LOW QUALITY PROTEIN: protein phosphatase 1 regulatory subunit 12A; M110; M130; M130 of smooth muscle myosin phosphatase; MBS; MBSP; myosin binding subunit; myosin phosphatase target subunit 1; myosin phosphatase, target subunit 1; myosin phosphatase-targeting subunit 1; myosin-binding subunit of myosin phosphatase; Mypt1; PP-1M; PP1M M110 subunit; PP1M subunit M110; Ppp1r12a; Protein phosphatase 1 regulatory subunit 12A; protein phosphatase 1, regulatory (inhibitor) subunit 12A; protein phosphatase 1, regulatory subunit 12A; protein phosphatase 1M 110 kda regulatory subunit; protein phosphatase myosin-binding subunit; Protein phosphatase subunit 1M; serine/threonine protein phosphatase PP1 smooth muscle regulatory subunit M110; si:dkey-28j4.1; smooth muscle myosin phosphatase myosin-binding subunit; unm p82emcf; unm_p82emcf; zgc:110448; zgc:110448 protein
Purification Method:
Antigen affinity chromatography
Gene ID (Entrez):
116670, 17931, 4659
Content And Storage:
-20°C
Applications:
Flow Cytometry, Immunocytochemistry, Immunohistochemistry (Paraffin), Western Blot
Formulation:
PBS with 5MG BSA and 0.05MG sodium azide
Gene Accession No.:
O14974, Q10728, Q9DBR7
Immunogen:
A synthetic peptide corresponding to a sequence at the N-terminus of human PPP1R12A (1-40aa MKMADAKQKRNEQLKRWIGSETDLEPPVVKRQKTKVKFDD).
Primary or Secondary:
Primary
Target Species:
Human, Mouse, Non-human Primate, Rat