CD46 Polyclonal Antibody, Invitrogen™
Manufacturer: Thermo Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | PIPA595335-Each-of-1 | In Stock | ₹ 44,705.10 |
PIPA595335 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 44,705.10
GST (18%): ₹ 8,046.918
Total Price: ₹ 52,752.018
Antigen
CD46
Classification
Polyclonal
Conjugate
Unconjugated
Gene
CD46
Gene Alias
AHUS2, antigen identified by monoclonal antibody TRA-2-10, brain microvascular membrane cofactor, brain microvascular membrane cofactor protein CD46, Cd46, CD46 antigen, complement regulatory protein, CD46 complement regulatory protein, CD46 molecule, CD46 molecule, complement regulatory protein, CD46 splice variant, complement membrane cofactor protein, complement regulatory protein, Mcp, MCP, complement activation regulator, measles virus receptor, membrane cofactor protein, membrane cofactor protein (CD46, trophoblast-lymphocyte cross-reactive antigen), membrane cofactor protein variant 10, membrane cofactor protein variant 7, membrane cofactor protein variant 8, membrane cofactor protein variant 9, MGC26544, MIC10, soluble membrane cofactor protein variant 11, soluble membrane cofactor protein variant 12, soluble membrane cofactor protein variant 13, TLX, TRA2.10, trophoblast leucocyte common antigen, trophoblast leukocyte common antigen, trophoblast-lymphocyte cross-reactive antig
Host Species
Rabbit
Purification Method
Affinity chromatography
Regulatory Status
RUO
Gene ID (Entrez)
17221
Content And Storage
Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Form
Lyophilized
Applications
Western Blot
Concentration
500 μg/mL
Formulation
PBS with 5MG BSA and 0.05MG sodium azide
Gene Accession No.
O88174
Gene Symbols
CD46
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of mouse CD46 (46-76aa ELPRPFEAMELKGTPKLFYAVGEKIEYKCKK).
Quantity
100 μg
Primary or Secondary
Primary
Target Species
Mouse
Product Type
Antibody
Isotype
IgG
Related Products
Description
- Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL
- CD46 (MCP, membrane cofactor protein) is a multifunctional cell surface transmembrane protein that binds and inactivates C3b and C4b complement fragments, regulates T cell-induced inflammatory responses by either inhibiting (CD46-1 isoform) or increasing (CD46-2 isoform) the contact hypersensitivity reaction
- CD46 also serves as a receptor for several human pathogens (both bacteria and viruses), and its ligation alteres T lymphocyte polarization toward antigen-presenting cells or target cells, inhibiting lymphocyte function
- CD46 is a protector of placental tissue and is also expressed on the inner acrosomal membrane of spermatozoa.
Compare Similar Items
Show Difference
Antigen: CD46
Classification: Polyclonal
Conjugate: Unconjugated
Gene: CD46
Gene Alias: AHUS2, antigen identified by monoclonal antibody TRA-2-10, brain microvascular membrane cofactor, brain microvascular membrane cofactor protein CD46, Cd46, CD46 antigen, complement regulatory protein, CD46 complement regulatory protein, CD46 molecule, CD46 molecule, complement regulatory protein, CD46 splice variant, complement membrane cofactor protein, complement regulatory protein, Mcp, MCP, complement activation regulator, measles virus receptor, membrane cofactor protein, membrane cofactor protein (CD46, trophoblast-lymphocyte cross-reactive antigen), membrane cofactor protein variant 10, membrane cofactor protein variant 7, membrane cofactor protein variant 8, membrane cofactor protein variant 9, MGC26544, MIC10, soluble membrane cofactor protein variant 11, soluble membrane cofactor protein variant 12, soluble membrane cofactor protein variant 13, TLX, TRA2.10, trophoblast leucocyte common antigen, trophoblast leukocyte common antigen, trophoblast-lymphocyte cross-reactive antig
Host Species: Rabbit
Purification Method: Affinity chromatography
Regulatory Status: RUO
Gene ID (Entrez): 17221
Content And Storage: Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Form: Lyophilized
Applications: Western Blot
Concentration: 500 μg/mL
Formulation: PBS with 5MG BSA and 0.05MG sodium azide
Gene Accession No.: O88174
Gene Symbols: CD46
Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of mouse CD46 (46-76aa ELPRPFEAMELKGTPKLFYAVGEKIEYKCKK).
Quantity: 100 μg
Primary or Secondary: Primary
Target Species: Mouse
Product Type: Antibody
Isotype: IgG
Antigen: MGA
Classification: Polyclonal
Conjugate: Unconjugated
Gene: MGA
Gene Alias: AV312082, C130042M01Rik, C80739, D030062C11Rik, FLJ12634, KIAA0518, Kiaa4252, LOW QUALITY PROTEIN: MAX gene-associated protein, Mad5, maltase-glucoamylase (alpha-glucosidase), Max dimerization protein 5, MAX dimerization protein MGA, MAX gene associated, MAX gene-associated protein, MAX protein-associated protein-like protein, MAX-associated protein, MAX-interacting protein, MGA, MGA, MAX dimerization protein, MGA-like protein, MXD5, RGD1561597
Host Species: Rabbit
Purification Method: Affinity chromatography
Regulatory Status: RUO
Gene ID (Entrez): 23269
Content And Storage: Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Form: Lyophilized
Applications: Western Blot
Concentration: 500 μg/mL
Formulation: PBS with 4MG trehalose and 0.05MG sodium azide
Gene Accession No.: Q8IWI9
Gene Symbols: MGA
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human MGA (2376-2415aa QKEAEAFAYYRRTHTANERRRRGEMRDLFEKLKITLGLLH).
Quantity: 100 μg
Primary or Secondary: Primary
Target Species: Human
Product Type: Antibody
Isotype: IgG
Antigen: RAB9
Classification: Polyclonal
Conjugate: Unconjugated
Gene: Rab9a
Gene Alias: 2410064E05Rik, AI195561, rab9, rab9 GTP-binding protein, RAB9, member RAS oncogene family, Rab9a, rab-9A, RAB9A, member RAS oncogene family, RAB9-like protein, ras-related protein Rab-9A, Sid 99, Sid6061p, Sid99
Host Species: Rabbit
Purification Method: Affinity chromatography
Regulatory Status: RUO
Gene ID (Entrez): 56382, 9367
Content And Storage: Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Form: Lyophilized
Applications: Flow Cytometry, Immunocytochemistry, Western Blot
Concentration: 500 μg/mL
Formulation: PBS with 5MG BSA and 0.05MG sodium azide
Gene Accession No.: P51151, Q9R0M6
Gene Symbols: Rab9, Rab9a
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Rab9 (156-193aa KDATNVAAAFEEAVRRVLATEDRSDHLIQTDTVNLHRK).
Quantity: 100 μg
Primary or Secondary: Primary
Target Species: Human, Mouse, Non-human Primate
Product Type: Antibody
Isotype: IgG
