NBP255689PE
Novus Biologicals™ ETV5/ERM Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP255689PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP255689PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
2119
Common Name
ETV5/ERM Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4.
Gene Alias
ERMEts-related protein ERM, ETS translocation variant 5, ets variant 5, ets variant gene 5 (ets-related molecule), ets-related molecule
Label Type
Unlabeled
Quantity
100μL
Source
E.Coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
ETV5
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50551. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Related Products
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ETV5/ERM
- Source: E.coli Amino Acid Sequence: AAGPVQGVGPAPAPHSLPEPGPQQQTFAVPRPPHQPLQMPKMMPENQYPSEQRFQRQ The ETV5/ERM Recombinant Protein Antigen is derived from E
- coli
- The ETV5/ERM Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 2119
Common Name: ETV5/ERM Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: ERMEts-related protein ERM, ETS translocation variant 5, ets variant 5, ets variant gene 5 (ets-related molecule), ets-related molecule
Label Type: Unlabeled
Quantity: 100μL
Source: E.Coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: ETV5
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50551. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
2119
Common Name:
ETV5/ERM Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
ERMEts-related protein ERM, ETS translocation variant 5, ets variant 5, ets variant gene 5 (ets-related molecule), ets-related molecule
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.Coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
ETV5
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50551. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 7555
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: CCHC-type zinc finger, nucleic acid binding protein, cellular nucleic acid binding protein, cellular nucleic acid-binding protein, DM2, erythroid differentiation-related, FLJ11631, PROMM, RNF163CNBP1ZNF9ZCCHC22, sterol regulatory element-binding protein, zinc finger protein 273, Zinc finger protein 9, zinc finger protein 9 (a cellular retroviral nucleic acid binding protein)
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
7555
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
CCHC-type zinc finger, nucleic acid binding protein, cellular nucleic acid binding protein, cellular nucleic acid-binding protein, DM2, erythroid differentiation-related, FLJ11631, PROMM, RNF163CNBP1ZNF9ZCCHC22, sterol regulatory element-binding protein, zinc finger protein 273, Zinc finger protein 9, zinc finger protein 9 (a cellular retroviral nucleic acid binding protein)
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 7555
Common Name: CNBP Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: CCHC-type zinc finger, nucleic acid binding protein, cellular nucleic acid binding protein, cellular nucleic acid-binding protein, DM2, erythroid differentiation-related, FLJ11631, PROMM, RNF163CNBP1ZNF9ZCCHC22, sterol regulatory element-binding protein,
Label Type: Unlabeled
Quantity: 100μL
Source: E.Coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: CNBP
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50552. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
7555
Common Name:
CNBP Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
CCHC-type zinc finger, nucleic acid binding protein, cellular nucleic acid binding protein, cellular nucleic acid-binding protein, DM2, erythroid differentiation-related, FLJ11631, PROMM, RNF163CNBP1ZNF9ZCCHC22, sterol regulatory element-binding protein,
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.Coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
CNBP
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50552. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 2309
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: AF6q21, AF6q21 protein, DKFZp781A0677, FKHRL1MGC31925, FKHRL1P2, forkhead box O3, forkhead box protein O3, forkhead homolog (rhabdomyosarcoma) like 1, Forkhead in rhabdomyosarcoma-like 1, forkhead, Drosophila, homolog of, in rhabdomyosarcoma-like 1, FOXO2, FOXO3Aforkhead box O3A, MGC12739
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
2309
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
AF6q21, AF6q21 protein, DKFZp781A0677, FKHRL1MGC31925, FKHRL1P2, forkhead box O3, forkhead box protein O3, forkhead homolog (rhabdomyosarcoma) like 1, Forkhead in rhabdomyosarcoma-like 1, forkhead, Drosophila, homolog of, in rhabdomyosarcoma-like 1, FOXO2, FOXO3Aforkhead box O3A, MGC12739
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__