NBP257628PE
Novus Biologicals™ PA28 Activator beta Subunit/PSME2 Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP257628PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP257628PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
5721
Common Name
PA28 Activator beta Subunit/PSME2 Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4
Gene Alias
11S regulator complex beta subunit, 11S regulator complex subunit beta, Activator of multicatalytic protease subunit 2, MCP activator, 31-kD subunit, PA28b, PA28betacell migration-inducing protein 22, proteasome (prosome, macropain) activator subunit 2 (P
Label Type
Unlabeled
Quantity
100μL
Source
E.coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
PSME2
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50532. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Related Products
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PA28 Activator beta Subunit/PSME2
- Source: E.coli Amino Acid Sequence: IPDPPPKDDEMETDKQEKKEVPKCGFLPGNEKVLSLLALVK The PA28 Activator beta Subunit/PSME2 Recombinant Protein Antigen is derived from E
- coli
- The PA28 Activator beta Subunit/PSME2 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 5721
Common Name: PA28 Activator beta Subunit/PSME2 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: 11S regulator complex beta subunit, 11S regulator complex subunit beta, Activator of multicatalytic protease subunit 2, MCP activator, 31-kD subunit, PA28b, PA28betacell migration-inducing protein 22, proteasome (prosome, macropain) activator subunit 2 (P
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: PSME2
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50532. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
5721
Common Name:
PA28 Activator beta Subunit/PSME2 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4
Gene Alias:
11S regulator complex beta subunit, 11S regulator complex subunit beta, Activator of multicatalytic protease subunit 2, MCP activator, 31-kD subunit, PA28b, PA28betacell migration-inducing protein 22, proteasome (prosome, macropain) activator subunit 2 (P
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
PSME2
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50532. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 91283
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: C9orf30, chromosome 9 open reading frame 30, FLJ34973, hypothetical protein LOC91283, L8, MGC17337, MSANTD3, Myb/SANT-like DNA-binding domain containing 3
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
91283
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
C9orf30, chromosome 9 open reading frame 30, FLJ34973, hypothetical protein LOC91283, L8, MGC17337, MSANTD3, Myb/SANT-like DNA-binding domain containing 3
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 91283
Common Name: MSANTD3 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: C9orf30, chromosome 9 open reading frame 30, FLJ34973, hypothetical protein LOC91283, L8, MGC17337, MSANTD3, Myb/SANT-like DNA-binding domain containing 3
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: MSANTD3
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52609. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
91283
Common Name:
MSANTD3 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4
Gene Alias:
C9orf30, chromosome 9 open reading frame 30, FLJ34973, hypothetical protein LOC91283, L8, MGC17337, MSANTD3, Myb/SANT-like DNA-binding domain containing 3
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
MSANTD3
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52609. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 10392
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: CARD4NLR family, CARD domain containing 1, caspase recruitment domain family, member 4, Caspase recruitment domain-containing protein 4, CLR7.1, NLRC1, nucleotide-binding oligomerization domain containing 1, nucleotide-binding oligomerization domain, leucine rich repeat and CARD domaincontaining 1, nucleotide-binding oligomerization domain-containing protein 1
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
10392
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
CARD4NLR family, CARD domain containing 1, caspase recruitment domain family, member 4, Caspase recruitment domain-containing protein 4, CLR7.1, NLRC1, nucleotide-binding oligomerization domain containing 1, nucleotide-binding oligomerization domain, leucine rich repeat and CARD domaincontaining 1, nucleotide-binding oligomerization domain-containing protein 1
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__