NBP258654PE
Novus Biologicals™ PDE6 beta Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP258654PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP258654PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
5158
Common Name
PDE6 beta Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4.
Gene Alias
CSNB3, EC 3.1.4, EC 3.1.4.35, GMP-PDE beta, PDEBrod cGMP-phosphodiesterase beta-subunit, phosphodiesterase 6B, cGMP-specific, rod, beta, rd1, rod cGMP-specific 3'-5'-cyclic phosphodiesterase subunit beta, RP40CSNBAD2
Label Type
Unlabeled
Quantity
100μL
Source
E.coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
PDE6B
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51897. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Related Products
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PDE6 beta
- Source: E.coli Amino Acid Sequence: DRDEIQLILPTRARLGKEPADCDEDELGEILKEELPGPTTFDIYEFHFSDL The PDE6 beta Recombinant Protein Antigen is derived from E
- coli
- The PDE6 beta Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 5158
Common Name: PDE6 beta Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: CSNB3, EC 3.1.4, EC 3.1.4.35, GMP-PDE beta, PDEBrod cGMP-phosphodiesterase beta-subunit, phosphodiesterase 6B, cGMP-specific, rod, beta, rd1, rod cGMP-specific 3'-5'-cyclic phosphodiesterase subunit beta, RP40CSNBAD2
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: PDE6B
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51897. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
5158
Common Name:
PDE6 beta Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
CSNB3, EC 3.1.4, EC 3.1.4.35, GMP-PDE beta, PDEBrod cGMP-phosphodiesterase beta-subunit, phosphodiesterase 6B, cGMP-specific, rod, beta, rd1, rod cGMP-specific 3'-5'-cyclic phosphodiesterase subunit beta, RP40CSNBAD2
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
PDE6B
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51897. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 54535
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: C6orf18, CCHCR1 coiled-coil alpha-helical rod protein 1, HCR, SBP
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
54535
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
C6orf18, CCHCR1 coiled-coil alpha-helical rod protein 1, HCR, SBP
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 10588
Common Name: MTHFS Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: 5,10-methenyltetrahydrofolate synthetase (5-formyltetrahydrofolatecyclo-ligase), 5-formyltetrahydrofolate cyclo-ligase, EC 6.3.3.25,10-methenyl-tetrahydrofolate synthetase, FLJ30410, HsT19268, Methenyl-THF synthetase
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: MTHFS
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50269. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
10588
Common Name:
MTHFS Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
5,10-methenyltetrahydrofolate synthetase (5-formyltetrahydrofolatecyclo-ligase), 5-formyltetrahydrofolate cyclo-ligase, EC 6.3.3.25,10-methenyl-tetrahydrofolate synthetase, FLJ30410, HsT19268, Methenyl-THF synthetase
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
MTHFS
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50269. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 8543
Common Name: LMO4 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: Breast tumor autoantigen, LIM domain only 4, LIM domain only protein 4, LIM domain transcription factor LMO4, LMO-4
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: LMO4
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51482. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
8543
Common Name:
LMO4 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
Breast tumor autoantigen, LIM domain only 4, LIM domain only protein 4, LIM domain transcription factor LMO4, LMO-4
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
LMO4
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51482. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml