Novus Biologicals™ MyD88 Inhibitor Peptide Set
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP2293285-Each-of-1 | In Stock | ₹ 1,24,233.12 |
NBP2293285 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 1,24,233.12
GST (18%): ₹ 22,361.962
Total Price: ₹ 1,46,595.082
Host Species
Human, Mouse, Rat, Xenopus, Zebrafish
For Use With (Application)
Blocking/Neutralizing, ELISA, Functional (Inhibition), In vitro assay, In vivo assay
Quantity
5 mg
Molecular Weight (g/mol)
3100
Form
Lyophilized
Components
2 x 1mg: MyD88 Homodimerization Inhibitor peptide (lyophilized) DRQIKIWFQNRRMKWKKRDVLPGT (MyD88 homodimerization sequence: RDVLPGT). Molecular weight: 31002 x 1mg: Antennapedia Control peptide (lyophilized) DRQIKIWFQNRRMKWKK. Molecular weight: 23615mg size will contain 5mg of each peptide (MyD88 Homodimerization Inhibitor peptide and Antennapedia Control peptide)
Content And Storage
Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Product Type
MyD88 Inhibitor Peptide Set
Inhibitors
MyD88
Related Products
Compare Similar Items
Show Difference
Host Species: Human, Mouse, Rat, Xenopus, Zebrafish
For Use With (Application): Blocking/Neutralizing, ELISA, Functional (Inhibition), In vitro assay, In vivo assay
Quantity: 5 mg
Molecular Weight (g/mol): 3100
Form: Lyophilized
Components: 2 x 1mg: MyD88 Homodimerization Inhibitor peptide (lyophilized) DRQIKIWFQNRRMKWKKRDVLPGT (MyD88 homodimerization sequence: RDVLPGT). Molecular weight: 31002 x 1mg: Antennapedia Control peptide (lyophilized) DRQIKIWFQNRRMKWKK. Molecular weight: 23615mg size will contain 5mg of each peptide (MyD88 Homodimerization Inhibitor peptide and Antennapedia Control peptide)
Content And Storage: Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Product Type: MyD88 Inhibitor Peptide Set
Inhibitors: MyD88
Host Species: Human, Mouse
For Use With (Application): Inhibition of TIRAP binding to TLR2 or TLR4
Quantity: 2 mg
Molecular Weight (g/mol): 3701.4
Form: Lyophilized
Components: TIRAP Inhibitor peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKKLQLRDAAPGGAIVS (TIRAP sequence is underlined). Molecular weight: 3701.4. Antennapedia Control peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKK. Molecular weight: 2361.
Content And Storage: Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Product Type: TIRAP (TLR2 and TLR4) Inhibitor Peptide Set
Inhibitors: TLR2, TLR4
Host Species: Human, Mouse
For Use With (Application): Inhibition of TIRAP binding to TLR2 or TLR4
Quantity: 5 mg
Molecular Weight (g/mol): 3701.4
Form: Lyophilized
Components: TIRAP Inhibitor peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKKLQLRDAAPGGAIVS (TIRAP sequence is underlined). Molecular weight: 3701.4. Antennapedia Control peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKK. Molecular weight: 2361.
Content And Storage: Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Product Type: TIRAP (TLR2 and TLR4) Inhibitor Peptide Set
Inhibitors: TLR2, TLR4