MED14 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP256318-Each-of-1 | In Stock | ₹ 55,271.76 |
NBP256318 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 55,271.76
GST (18%): ₹ 9,948.917
Total Price: ₹ 65,220.677
Antigen
MED14
Classification
Polyclonal
Dilution
Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias
Activator-recruited cofactor 150 kDa component, ARC150, Cofactor required for Sp1 transcriptional activation subunit 2, cofactor required for Sp1 transcriptional activation, subunit 2 (150kD), CRSP150, CRSP2cofactor required for Sp1 transcriptional activation, subunit 2, 150kDa, CSRP, CXorf4MGC104513, EXLM1CRSP complex subunit 2, human homolog of yeast RGR1, mediator complex subunit 14DRIP150, mediator of RNA polymerase II transcription subunit 14, RGR1RGR1 homolog, Thyroid hormone receptor-associated protein complex 170 kDa component, thyroid hormone receptor-associated protein complex component TRAP170, transcriptional co-activator CRSP150, Transcriptional coactivator CRSP150, Trap170, TRAP170hRGR1, vitamin D receptor-interacting protein complex component DRIP150, Vitamin D3 receptor-interacting protein complex 150 kDa component
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
MED14
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PIAPPGTPAVVLKSKMLFFLQLTQKTSVPPQEPVSIIVPIIYDMASGTTQQADIPRQQNSSVAAPMMVSNILKRFAEMNP
Quantity
100 μL
Research Discipline
Signal Transduction
Gene ID (Entrez)
9282
Target Species
Human
Isotype
IgG
Related Products
Description
- Description MED14 Polyclonal specifically detects MED14 in Human samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: MED14
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: Activator-recruited cofactor 150 kDa component, ARC150, Cofactor required for Sp1 transcriptional activation subunit 2, cofactor required for Sp1 transcriptional activation, subunit 2 (150kD), CRSP150, CRSP2cofactor required for Sp1 transcriptional activation, subunit 2, 150kDa, CSRP, CXorf4MGC104513, EXLM1CRSP complex subunit 2, human homolog of yeast RGR1, mediator complex subunit 14DRIP150, mediator of RNA polymerase II transcription subunit 14, RGR1RGR1 homolog, Thyroid hormone receptor-associated protein complex 170 kDa component, thyroid hormone receptor-associated protein complex component TRAP170, transcriptional co-activator CRSP150, Transcriptional coactivator CRSP150, Trap170, TRAP170hRGR1, vitamin D receptor-interacting protein complex component DRIP150, Vitamin D3 receptor-interacting protein complex 150 kDa component
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: MED14
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PIAPPGTPAVVLKSKMLFFLQLTQKTSVPPQEPVSIIVPIIYDMASGTTQQADIPRQQNSSVAAPMMVSNILKRFAEMNP
Quantity: 100 μL
Research Discipline: Signal Transduction
Gene ID (Entrez): 9282
Target Species: Human
Isotype: IgG
Antigen: ARHGEF1
Classification: Polyclonal
Dilution: Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: 115 kDa guanine nucleotide exchange factor, 115-kD protein, GEF1, LBCL2LSC, Lsc homolog, p115RhoGEF, P115-RHOGEF, Rho guanine nucleotide exchange factor (GEF) 1, rho guanine nucleotide exchange factor 1, Sub1.5
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Western Blot, Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: ARHGEF1
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LRVPVPPNVAFELDRTRADLISEDVQRRFVQEVVQSQQVAVGRQLEDFRSKRLMGMTPWEQELAQLEAWVGRDRASYEARERHVAERLLMHLEEMQHTISTDEEKSAAVVNAIGL
Quantity: 100 μL
Research Discipline: Cell Cycle and Replication
Gene ID (Entrez): 9138
Target Species: Human
Isotype: IgG
Antigen: C17orf59
Classification: Polyclonal
Dilution: Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: chromosome 17 open reading frame 59, FLJ20014, hypothetical protein LOC54785, PRO2472
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of human BORC6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Western Blot, Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: C17orf59
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PETDLLAVAEHQALVFGGGPGRTSSEPPAGLRVSGEEETENVGGANRHPRTSPKTSSCGVVHRPEREALENEPGPQGTLS
Quantity: 100 μL
Research Discipline: __
Gene ID (Entrez): 54785
Target Species: Human
Isotype: IgG
