N acetyl transferase 5 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP256635-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP256635 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
N acetyl transferase 5
Classification
Polyclonal
Dilution
Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias
dJ1002M8.1, dJ1175I6.2 (N-terminal acetyltransferase complex ard1 subunit), EC 2.3.1.88, homolog), N(alpha)-acetyltransferase 20, NatB catalytic subunit, N-acetyltransferase 3 homolog, N-acetyltransferase 5, N-acetyltransferase 5 (ARD1 homolog, S. cerevisiae), N-acetyltransferase 5 (GCN5-related, putative), N-acetyltransferase 5, ARD1 subunit (arrest-defective 1, S. cerevisiae, N-alpha-acetyltransferase 20, NatB catalytic subunit, NAT3N-terminal acetyltransferase B complex catalytic subunit NAT5, NAT5dJ1002M8.1 (N-terminal acetyltransferase complex ard1 subunit), NatB complex subunit NAT5, N-terminal acetyltransferase B complex catalytic subunit NAA20, N-terminal acetyltransferase complex ARD1 subunit
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Gene ID (Entrez)
51126
Target Species
Human
Isotype
IgG
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
NAA20
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LMELLEEISERKGGFFVDLFVRVSNQVAVNMYKQLGYSVYRTVIEYYSASNGEPDEDAYDMRKALSRDTEKKSI
Quantity
100 μL
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Related Products
Description
- N acetyl transferase 5 Polyclonal specifically detects N acetyl transferase 5 in Human samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: N acetyl transferase 5
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: dJ1002M8.1, dJ1175I6.2 (N-terminal acetyltransferase complex ard1 subunit), EC 2.3.1.88, homolog), N(alpha)-acetyltransferase 20, NatB catalytic subunit, N-acetyltransferase 3 homolog, N-acetyltransferase 5, N-acetyltransferase 5 (ARD1 homolog, S. cerevisiae), N-acetyltransferase 5 (GCN5-related, putative), N-acetyltransferase 5, ARD1 subunit (arrest-defective 1, S. cerevisiae, N-alpha-acetyltransferase 20, NatB catalytic subunit, NAT3N-terminal acetyltransferase B complex catalytic subunit NAT5, NAT5dJ1002M8.1 (N-terminal acetyltransferase complex ard1 subunit), NatB complex subunit NAT5, N-terminal acetyltransferase B complex catalytic subunit NAA20, N-terminal acetyltransferase complex ARD1 subunit
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 51126
Target Species: Human
Isotype: IgG
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: NAA20
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LMELLEEISERKGGFFVDLFVRVSNQVAVNMYKQLGYSVYRTVIEYYSASNGEPDEDAYDMRKALSRDTEKKSI
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: RDH5
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: 11-cis RDH, 11-cis retinol dehydrogenase, 9,9-cis-retinol specific dehydrogenase, EC 1.1.1, EC 1.1.1.105, FLJ39337, FLJ97089, HSD17B, RDH1, retinol dehydrogenase 1, retinol dehydrogenase 5 (11-cis and 9-cis), retinol dehydrogenase 5 (11-cis/9-cis), SDR9C5, short chain dehydrogenase/reductase family 9C, member 5
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 5959
Target Species: Human
Isotype: IgG
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: RDH5
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:NNAGVAGIIGPTPWLTRDDFQRVLNVNTMGPIGVTLALL
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: __
Classification: __
Dilution: __
Gene Alias: 11-cis RDH, 11-cis retinol dehydrogenase, 9,9-cis-retinol specific dehydrogenase, EC 1.1.1, EC 1.1.1.105, FLJ39337, FLJ97089, HSD17B, RDH1, retinol dehydrogenase 1, retinol dehydrogenase 5 (11-cis and 9-cis), retinol dehydrogenase 5 (11-cis/9-cis), SDR9C5
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Gene ID (Entrez): 5959
Target Species: __
Isotype: __
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.