YB1 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP258086-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP258086 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
YB1
Classification
Polyclonal
Dilution
Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias
BP-8, CBF-A, class II, Y box-binding protein I, CSDA2, CSDB, DBPB CCAAT-binding transcription factor I subunit A, EFI-A, Enhancer factor I subunit A, MDR-NF1, MGC104858, MGC110976, MGC117250, NSEP1 Y-box-binding protein 1, nuclease-sensitive element-binding protein 1, Y box binding protein 1, YB1 DNA-binding protein B, YB-1 Y-box transcription factor, YBX1
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
YBX1
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:TQGQQPPQRRYRRNFNYRRRRPENPKPQDGKETKAADPPAENSSAPEAEQ
Quantity
100 μL
Research Discipline
Breast Cancer, Cancer, DNA Repair, Epigenetics, Ovarian Carcinoma Cell Markers, Stem Cell Markers, Transcription Factors and Regulators, Translation Control
Gene ID (Entrez)
4904
Target Species
Human
Isotype
IgG
Related Products
Description
- YB1 Polyclonal specifically detects YB1 in Human samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: YB1
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: BP-8, CBF-A, class II, Y box-binding protein I, CSDA2, CSDB, DBPB CCAAT-binding transcription factor I subunit A, EFI-A, Enhancer factor I subunit A, MDR-NF1, MGC104858, MGC110976, MGC117250, NSEP1 Y-box-binding protein 1, nuclease-sensitive element-binding protein 1, Y box binding protein 1, YB1 DNA-binding protein B, YB-1 Y-box transcription factor, YBX1
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: YBX1
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:TQGQQPPQRRYRRNFNYRRRRPENPKPQDGKETKAADPPAENSSAPEAEQ
Quantity: 100 μL
Research Discipline: Breast Cancer, Cancer, DNA Repair, Epigenetics, Ovarian Carcinoma Cell Markers, Stem Cell Markers, Transcription Factors and Regulators, Translation Control
Gene ID (Entrez): 4904
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Alias: BP-8, CBF-A, class II, Y box-binding protein I, CSDA2, CSDB, DBPB CCAAT-binding transcription factor I subunit A, EFI-A, Enhancer factor I subunit A, MDR-NF1, MGC104858, MGC110976, MGC117250, NSEP1 Y-box-binding protein 1, nuclease-sensitive element-bindi
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Research Discipline: __
Gene ID (Entrez): 4904
Target Species: __
Isotype: __
Antigen: RAPGEF2
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: CNrasGEF, KIAA0313, Neural RAP guanine nucleotide exchange protein, nRap GEP, NRAPGEP, PDZ domain containing guanine nucleotide exchange factor (GEF) 1, PDZGEF1, PDZ-GEF1PDZ domain-containing guanine nucleotide exchange factor 1, RA(Ras/Rap1A-associating)-GEF, RA-GEFDKFZP586O1422, Rap guanine nucleotide exchange factor (GEF) 2, rap guanine nucleotide exchange factor 2, Rap-GEP
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: RAPGEF2
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:RMVARSSDTAGPSSVQQPHGHPTSSRPVNKPQWHKPNESDPRLAPYQSQGFSTEEDEDEQVSA
Quantity: 100 μL
Research Discipline: Signal Transduction
Gene ID (Entrez): 9693
Target Species: Human
Isotype: IgG