SIRP alpha/CD172a Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP258429-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP258429 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
SIRP alpha/CD172a
Classification
Polyclonal
Dilution
Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Alias
Bit, BITbrain-immunoglobulin-like molecule with tyrosine-based activation motifs, Brain Ig-like molecule with tyrosine-based activation motifs, CD172 antigen-like family member A, CD172a, CD172a antigen, Inhibitory receptor SHPS-1, Macrophage fusion receptor, MFRtyrosine phosphatase SHP substrate 1, MYD1, MYD-1, MyD-1 antigen, P84, protein tyrosine phosphatase, non-receptor type substrate 1, PTPNS1, SHP substrate 1, SHPS-1, SHPS1CD172A, signal-regulatory protein alpha, Signal-regulatory protein alpha-1, Signal-regulatory protein alpha-2, Signal-regulatory protein alpha-3, SIRPalpha, SIRP-ALPHA-1, Sirp-alpha-2, SIRPalpha2, Sirp-alpha-3, SIRPtyrosine-protein phosphatase non-receptor type substrate 1
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
SIRPA
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:NNHTEYASIQTSPQPASEDTLTYADLDMVHLNRTPKQPAPKPEPSFSEYASVQVPRK
Quantity
100 μL
Research Discipline
GPCR, Protein Phosphatase, Signal Transduction
Gene ID (Entrez)
140885
Target Species
Human
Isotype
IgG
Related Products
Description
- SIRP alpha/CD172a Polyclonal specifically detects SIRP alpha/CD172a in Human samples
- It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: SIRP alpha/CD172a
Classification: Polyclonal
Dilution: Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Alias: Bit, BITbrain-immunoglobulin-like molecule with tyrosine-based activation motifs, Brain Ig-like molecule with tyrosine-based activation motifs, CD172 antigen-like family member A, CD172a, CD172a antigen, Inhibitory receptor SHPS-1, Macrophage fusion receptor, MFRtyrosine phosphatase SHP substrate 1, MYD1, MYD-1, MyD-1 antigen, P84, protein tyrosine phosphatase, non-receptor type substrate 1, PTPNS1, SHP substrate 1, SHPS-1, SHPS1CD172A, signal-regulatory protein alpha, Signal-regulatory protein alpha-1, Signal-regulatory protein alpha-2, Signal-regulatory protein alpha-3, SIRPalpha, SIRP-ALPHA-1, Sirp-alpha-2, SIRPalpha2, Sirp-alpha-3, SIRPtyrosine-protein phosphatase non-receptor type substrate 1
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: SIRPA
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:NNHTEYASIQTSPQPASEDTLTYADLDMVHLNRTPKQPAPKPEPSFSEYASVQVPRK
Quantity: 100 μL
Research Discipline: GPCR, Protein Phosphatase, Signal Transduction
Gene ID (Entrez): 140885
Target Species: Human
Isotype: IgG
Antigen: FAM69B
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: C9orf136, FAM69B family with sequence similarity 69, member B, pp6977
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: FAM69B
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:EELGTQLRTCTTLSGLASQVEAHHSLVLSHLKTLLWK
Quantity: 100 μL
Research Discipline: __
Gene ID (Entrez): 138311
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Alias: C9orf136, FAM69B family with sequence similarity 69, member B, pp6977
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Research Discipline: __
Gene ID (Entrez): 138311
Target Species: __
Isotype: __
